KEGG   Sus scrofa (pig): 414914
Entry
414914            CDS       T01009                                 

Symbol
COL17A1
Name
(RefSeq) collagen alpha-1(XVII) chain
  KO
K07603  collagen type XVII alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    414914 (COL17A1)
SSDB
Motif
Pfam: Collagen DUF2868 DUF5006
Other DBs
NCBI-GeneID: 414914
NCBI-ProteinID: XP_013839164
UniProt: I3LUH8
Position
14
AA seq 1506 aa
MDVTKKNKRDGTEVTERIITETVTTRLTSLPPKGGTSNGYAKTGSLGGGSRLEKQSLMHG
SSSYINSSGSTRGNASTSSYRRAHSPASTLPNSPGSTFERKTHVTRHGTYEGSSSGNSSP
EYPRKEFASSSTRGRSQTRESEIRVRLQSASPSTRWTELDDVKRLLKGSRSASVSPTRNS
SNTLPIPKKGTVETRVVTASSQSVSGTYDATILDANLPSHVWSSTLPAGSSMGTYHNNMT
TQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGISTSSSVFGMQNNLAPSSSALSHGTA
TTSTAYGVKKNMPQSPAVVSTGVSTSAASTTSIQNDDLLHKDCKFLILEKDNVPAKKEME
LLIMTKDSGKVFTASPASVTATSFSEDTLKKEKQAAYTTDTYVMAEANGDVKTVSTKGKA
TSADIHGYDHRRSGGGGGGGGGGIGSAGGGTGSGKGMWGAAPVWCPCGSWCSWWKWLLGL
LLTWLLLLGLLFGLIALAEEVRKLKARVDELEKVRSSLLHYEKMERSSQDAVQGAAPRTG
PDVGKSGLDGYSQEDLWQYVWAKLIAEQENGNLRGSPGPKGDMGSQGPKGDRGFPGTPGI
PGPLGHPGPEGPKGQKGSVGEPGMEGPMGQRGREGPIGPRGEPGPPGFGDKGDRGAAGPP
GVPGPPGVPGSVGPKGSSGSPGPQGSPGSVGPQGLRGEVGLPGAKGDKGLMGPPGPKGDQ
GEKGPRGLTGEPGLKGLPGAVGEPGAKGAMGPAGPDGHQGPRGEQGLPGMPGTRGSPGPS
GDPGKPGLTGPQGPQGLPGSPGRPGPRGEPGAPGRIMTSEGSSTLTVPGPPGPPGAMGPP
GPPGAPGPVGPAGLPGQQGPRGEPGLAGESFLGSSSSISEVLAAQGLDLRGPPGPPGPPG
PPGLSIPGPPGPRGPAGEGLPGPPGPPGSLLTSSETISGPPGPPGPPGPKGDQGPPGPRG
HQGERGLPGFSAAGSSSLGLNLQGPPGPPGPQGPKGDKGDPGVPGGPSRGGSSSGTMLMA
GPPGPPGPPGPPGSFSGSSLEIQQYISDYLQSDSIRSYLSGVPGPPGPRGPPGPVTTIGG
ETFDYSELASLVVSYLQTSGYSISTSSASISSADILAALQRDDVRQYLQQFLTGPQGPPG
PPGASGDWSLQSLDYAELSSRILSYMSSSGVSIGLPGPPGPPGLPGTSYEELLSLLQGSE
FRGIVGPPGPPGPPGLPGSMWSSINMEELSAYLQTAGLSSIPGPPGPPGPPGPRGPPGVS
GALATYAAENSDSFRSELISYLTSPDVRSFIVGPPGPPGPPGESRLVSVDSSYSLDSSSS
SLSRGSSYSSSMGIGGASGGSLGEGGAFGLDMGMGRGYGTVAEGGMFGGNGGFGAGYAGG
LDYNELAVRVSESMQRQGLLQGMAYTVQGPPGRPGPQGPPGVSKVFSAYSNVTADLMDFF
RTYGAIPGPPGQKGEVGISGPKGERGPAGPPGRPGPPGPRGHKGEKGDKGDQVYAGRRRR
SIAVKP
NT seq 4521 nt   +upstreamnt  +downstreamnt
atggatgtgaccaagaaaaacaaacgagatggtactgaagtcactgaaagaattatcacg
gaaacagtaactacaagacttacgtccttaccaccaaaaggggggaccagcaatggctat
gctaaaacaggttctcttggtggagggagccggctggagaaacagagcctaatgcatggc
agcagcagctacataaactccagtggaagcacccgaggcaatgcctccacctccagttac
aggagggcccattcgcctgcctccacgctgcccaactctccaggctcaacctttgagagg
aaaacccatgtcacccgccatggaacatatgaagggagctccagtggcaactcttcccca
gaataccctcggaaggaatttgcatcttcttcaaccagaggaaggagccaaacacgagag
agcgagatccgagtccgactgcagagtgcatccccatccacccgatggacggaattggat
gatgttaagcgtttgctcaaggggagccgatcagcgagcgtgagccccacccggaattcc
tctaacacactccccatccccaagaaaggcaccgtggagaccagagtggtgacggcgagc
tcccagtcagtgtctggcacttatgacgccaccatcctggatgccaaccttccctcccac
gtgtggtcttccacgttgccggcagggtcctccatgggcacctatcacaacaacatgaca
acccagagctcatccctcctcaacaccaatgcctattctgcaggatcagtctttggagtt
ccaaataacatggcatcctgctcccctactctgcacccgggaatcagcaccagctcctca
gtgttcggcatgcagaacaatctggcccccagctcttccgccctctcccatggcacggcc
accacatccacagcgtatggtgtgaagaaaaacatgccccagagccctgccgtcgtgagc
accggggtgtctacctctgcggccagcaccacaagcatccagaacgatgacctcttgcac
aaggactgtaaattcctgatcctggagaaagacaacgtgcccgccaagaaggagatggag
ctgctgatcatgaccaaagacagtgggaaggtctttacggcctcccctgccagcgtcact
gcaacttctttttcagaggataccctgaaaaaggaaaaacaagctgcatacaccactgac
acctacgtaatggcagaagctaatggagatgtgaagaccgtgtccacaaagggcaaggcc
acctctgcagacatccatggctacgaccaccgccgcagtggaggtggtggtggcggtggt
ggtggcggcattggcagtgccggtgggggcactggcagcggcaaaggcatgtggggggca
gcgccagtctggtgcccctgcggctcctggtgcagctggtggaagtggctgctgggtctg
ctgctgacctggctgctgctgctggggctgctctttggcctcatcgctctggcggaggaa
gtgaggaagctgaaagcacgtgtggatgagctggagaaggtcaggagcagcctgctgcat
tacgagaagatggagaggagcagccaggatgctgtgcagggtgctgcacccaggacgggg
ccagatgtggggaaatctggacttgatggctacagtcaggaggacctctggcaatatgtg
tgggccaagctgatagcagaacaggaaaatggaaacctccgaggaagccctggccctaaa
ggtgacatgggaagccaaggtccaaaaggagatcgagggttccctgggactccgggtatc
cctgggcccttgggccacccaggtccggagggaccaaaaggacaaaaaggcagtgtggga
gagcccggcatggagggacccatgggccagagagggcgagaaggccccataggacctcgt
ggtgaacctgggcctcctgggtttggagacaaaggagacagaggggctgctggtccaccg
ggtgttccaggcccacctggtgtcccaggttctgtgggccccaaaggttccagcggttct
cctggcccacagggttccccaggctctgtaggtccccaagggctccgaggtgaagtggga
ctccctggtgccaaaggtgacaaagggcttatgggaccaccaggacccaaaggtgaccag
ggtgagaaaggaccacgaggcctcacaggggagcctggcttgaaaggtttgcctggtgct
gtgggtgagcccggagctaaaggagcaatgggacctgctggccccgacggacaccaaggc
ccaagaggggaacaaggtcttccagggatgcctggaacccggggctcaccaggaccttct
ggagacccaggaaagccaggtctcacaggaccccaaggacctcagggacttcctggtagc
cctggccgaccagggcctagaggtgaaccaggagctccaggcaggatcatgacttcagag
ggatcatcaactctcactgtcccaggacctccaggacctcctggagccatgggacctccg
ggacctccaggtgctccaggccctgttggcccagctggtctcccaggacagcaaggccca
cgaggggaaccaggacttgctggcgaatcattcttgggcagcagtagctccatctctgag
gtcctcgctgctcagggtctggacttacgaggtcctccaggcccacctgggccacctggc
ccaccaggactgtccattccaggccccccaggaccccgaggcccagcaggggaaggcttg
ccaggcccgccaggcccaccaggatctctcctgaccagctcagagaccatctccggccct
ccaggcccacctggccccccaggccccaaaggagaccaaggtcccccaggcccccgagga
caccaaggcgagcgaggcctcccagggttctcagccgcaggctccagttctcttggactc
aacctgcagggaccaccaggcccaccgggcccccagggacccaagggtgacaaaggtgat
cctggagtcccaggtggtccttctcgagggggatcgtcatcgggcaccatgctcatggcg
ggcccgccaggcccaccagggccccctgggcctccaggctccttcagcggctccagcctg
gagattcagcagtacatctctgactacctgcagagtgacagtatcaggtcttatctctct
ggagttccgggccctccaggcccacgtggtcccccggggcctgtcaccaccatcgggggt
gagactttcgactactcggagctggccagcctcgtcgtgagctatttacagacctcaggg
tacagcatcagcacatcctctgcctccatctcttctgcagacatcctggctgcactccag
cgggatgacgtgcgtcagtatctccagcagttcctgacgggccctcagggtccccccggt
ccaccgggagccagcggagattggtccctccagtctttggactacgccgagctgagcagc
cgcatcctcagctacatgtccagctccggagtcagcattgggcttcctggccccccggga
ccaccaggcttgccaggcacatcctacgaggaactcctctccttgctccaagggtctgaa
ttcagaggcatcgtcggacccccaggtccccctgggccaccagggcttccaggcagcatg
tggtccagcatcaacatggaggagctctcagcctacctgcagactgccgggctgtcatcc
atcccaggccctcctggccctcctggtcccccgggccctcgagggcctccgggtgtctca
ggagctctggcgacatatgcagctgaaaacagtgacagcttccggagtgagctcatcagc
tacctcacaagtcctgatgtgcgtagcttcattgtcggcccccctggcccccctggcccc
cctggggaaagccgcctggtgtcggtggacagctcctatagcctggacagcagctcctcc
tccctcagtcggggcagctcctacagctcttccatgggcataggaggagccagtgggggc
tccctgggcgaagggggagcctttggcctggacatgggcatgggccggggctatgggaca
gtggcagaaggtggcatgttcggtggcaatggtggcttcggggccggctatgccggaggt
ctggactacaacgagctggccgttcgggtgtccgagagcatgcagcgtcagggtctgctc
caagggatggcctacacggtgcagggcccaccaggccggcctgggccccaggggccccct
ggagtcagcaaggtcttctctgcctacagcaacgtgactgcggatctcatggactttttc
agaacttatggagccatcccaggaccccctgggcagaaaggagaagtgggcatctctgga
cccaaaggtgagagaggccctgcaggaccaccaggtcggcctgggccacccggccctcga
gggcacaagggagaaaaaggagacaaaggtgaccaagtctacgctggacggagaaggaga
agcattgccgtcaagccatga

DBGET integrated database retrieval system