KEGG   Sus scrofa (pig): 445459Help
Entry
445459            CDS       T01009                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04151  PI3K-Akt signaling pathway
ssc04217  Necroptosis
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04630  Jak-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc05142  Chagas disease (American trypanosomiasis)
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    445459 (IFNB1)
   04151 PI3K-Akt signaling pathway
    445459 (IFNB1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    445459 (IFNB1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    445459 (IFNB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    445459 (IFNB1)
   04621 NOD-like receptor signaling pathway
    445459 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    445459 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    445459 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    445459 (IFNB1)
  Development
   04380 Osteoclast differentiation
    445459 (IFNB1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    445459 (IFNB1)
   05162 Measles
    445459 (IFNB1)
   05164 Influenza A
    445459 (IFNB1)
   05161 Hepatitis B
    445459 (IFNB1)
   05160 Hepatitis C
    445459 (IFNB1)
   05168 Herpes simplex infection
    445459 (IFNB1)
   05163 Human cytomegalovirus infection
    445459 (IFNB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    445459 (IFNB1)
   05165 Human papillomavirus infection
    445459 (IFNB1)
   05142 Chagas disease (American trypanosomiasis)
    445459 (IFNB1)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Interferons
   445459 (IFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon SesA
Motif
Other DBs
NCBI-GeneID: 445459
NCBI-ProteinID: NP_001003923
Ensembl: ENSSSCG00000005163
Vega: OTTSUSG00000001528
UniProt: Q68IQ4
Position
1
AA seq 186 aa AA seqDB search
MANKCILQIALLMCFSTTALSMSYDVLRYQQRSSNLACQKLLEQLPGTPQYCLEDRMNFE
VPEEIMQPPQFQKEDAVLIIHEMLQQIFGILRRNFSSTGWNETVIKTILVELDGQMDDLE
TILEEIMEEENFPRGDMTILHLKKYYLSILQYLKSKEYRSCAWTVVQVEILRNFSFLNRL
TDYLRN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaagtgcatcctccaaatcgctctcctgatgtgtttctccaccacagctctt
tccatgagctatgatgtgcttcgataccaacaaaggagcagcaatttggcatgtcagaag
ctcctggaacagttgcctgggactcctcaatattgcctcgaagataggatgaacttcgag
gtccctgaggagattatgcaaccaccacaattccagaaggaagatgcagtattgattatc
cacgagatgctccagcagatcttcggcattctcagaagaaatttctctagcactggctgg
aatgaaaccgtcattaagactatccttgtggaacttgatgggcagatggatgacctggag
acaatcctggaggaaatcatggaggaggaaaatttccccaggggagacatgaccattctt
cacctgaagaaatattacttgagcattctgcagtacctgaagtccaaggagtacagaagc
tgtgcctggacagtcgtccaagtggaaatcctcaggaacttttctttccttaacagactt
acagattacctccggaactga

DBGET integrated database retrieval system