KEGG   Sus scrofa (pig): 448809Help
Entry
448809            CDS       T01009                                 

Gene name
COL10A1
Definition
(RefSeq) collagen alpha-1(X) chain precursor
  KO
K19479  collagen, type X, alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    448809 (COL10A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 448809
NCBI-ProteinID: NP_001005153
Ensembl: ENSSSCG00000004436
UniProt: Q9N178 A0A4X1V761
Position
1
AA seq 675 aa AA seqDB search
MLPQTALLLLLLSLNLVHGVFYTEQYQTPTGIKGPPSNTKAQFFIPYAIKSKGISLRGEQ
GIPGPPGPAGPRGHPGPSGPPGKPGFGSPGPQGQPGLPGPPGPSATGKPGLPGPQGKPGE
RGPYGPKGDMGPAGLPGPRGPPGPPGIPGPAGISVTGKPGQQGPAGAPGPRGFPGEKGAP
GVPGINGQKGETGYGAPGRPGDRGLPGPQGPMGPPGPPGVGKRGENGFPGQPGIKGDRGF
PGESGPAGPPGPQGPPGEQGREGIGKPGAPGAAGQPGLPGTKGHPGAPGMAGPPGAPGFG
KPGLPGLKGQRGPIGLPGAPGAKGEQGPAGHPGEPGLTGPPGSRGPQGPKGIPGNNGVPG
PKGEIGLAGPAGFPGAKGERGPSGLDGKPGYPGEPGLNGPKGNPGLPGPKGDPGIGGPPG
LPGPVGPAGAKGVPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGNPGPPGPAG
IATKGLNGPTGPPGPPGPKGHAGEPGLPGPPGPPGPPGQAVPPEGFVKEGQRAFVSANQG
VTGMPVSAFTVILSKAYPAIGAPIPFDKILYNGQQHYDPKTGIFTCRIPGIYYFSYHIHV
KGTHAWVGLYKNGTPVMYTYDEYVKGYLDQASGSAILDLTDNDQVWLQLPNAGSNGLYSS
EYVHSSFSGFLVAPM
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgctgccacaaacagcccttttgctgctgctattgtccttgaacttggttcatggagtg
ttttatactgagcaataccaaacacctacaggcataaaaggcccaccatccaacaccaag
gcacagttcttcatcccctacgccataaagagtaaaggtatatcactaagaggagagcaa
ggtattcccggtccaccaggccccgctggaccacgagggcacccaggtccatctggaccc
ccaggaaaaccaggcttcggaagccctggaccccaaggacagccagggctgccaggacca
ccaggaccatcagccactgggaagccaggtttgccaggaccccaaggaaaaccaggggag
agaggaccatatggaccaaaaggagatatgggaccggctggtttaccaggaccacggggc
ccaccagggccacctggtatccccggcccggctggaatttctgttacaggaaaacctgga
caacagggacctgcaggagccccaggacccaggggctttcctggagaaaagggtgcacca
ggagtccctggtatcaatggacagaaaggggaaacgggatatggtgctcctggccgccca
ggtgacaggggccttccaggcccccagggcccaatgggaccacctggccctcctggagtg
ggaaagagaggggaaaatgggtttcccggacaaccaggcatcaaaggtgatcggggcttt
ccaggagaaagtggaccggctggtccaccaggcccccaaggtcctcctggggaacaagga
cgagaaggcattggaaagccaggagctcctggagccgcaggccagccagggcttccaggg
acaaaaggtcaccccggggctccaggaatggctgggcctccaggggctcctggctttggg
aaaccaggcttgccaggcctgaagggacaaagaggtcctataggccttccaggggctcca
ggtgccaaaggggaacaaggcccggcaggtcatcctggggaaccaggtctgactggaccc
cctggaagtaggggaccccaaggaccaaaaggcatcccaggcaataacggggtcccaggc
cctaagggtgagatagggctggctgggcctgcaggattccctggggctaagggagaaagg
ggcccctccgggttagatggaaaaccagggtacccaggagaaccaggtctcaatggtccc
aagggtaacccagggttacccggcccaaaaggtgaccctggaattggaggacctcctggt
ctcccaggccctgtgggcccagcaggagctaagggagtgcctggacacaatggtgaggct
gggccaagaggtgcccctggaataccaggtaccagaggtcccatcgggccaccaggcatt
ccaggattccctggctctaaaggggatccaggaaatccaggtcctcctggtccagctggc
atagcaactaagggcctcaatggacccactgggccaccagggcctccaggaccaaaaggt
catgctggagagcctggcctcccagggcccccagggcccccaggccctccaggccaagcg
gtcccacccgaaggctttgtaaaggaaggacagagggcttttgttagtgccaaccaggga
gtaacaggaatgcctgtatctgccttcactgtgattctctccaaagcttacccagctata
ggtgctcccatcccctttgataagattttatataacgggcaacagcactatgacccaaaa
actggaatctttacctgcaggatacctggaatctattacttctcctaccacattcacgtg
aaggggacccatgcttgggtgggcctgtataaaaatggcacccctgtcatgtacacctat
gatgaatatgtcaaaggctacctggatcaggcttcagggagtgccatccttgatctcaca
gataatgaccaggtatggctccagctgcccaacgctgggtcgaacgggctgtactcctct
gagtacgtccactcctctttctcaggattcctagtggctccaatgtga

DBGET integrated database retrieval system