KEGG   Sus scrofa (pig): 448846Help
Entry
448846            CDS       T01009                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00071  Fatty acid degradation
ssc00280  Valine, leucine and isoleucine degradation
ssc00310  Lysine degradation
ssc00380  Tryptophan metabolism
ssc00410  beta-Alanine metabolism
ssc00640  Propanoate metabolism
ssc00650  Butanoate metabolism
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc01212  Fatty acid metabolism
ssc03320  PPAR signaling pathway
ssc04146  Peroxisome
Module
ssc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
ssc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ssc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    448846 (EHHADH)
   00650 Butanoate metabolism
    448846 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    448846 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    448846 (EHHADH)
   00310 Lysine degradation
    448846 (EHHADH)
   00380 Tryptophan metabolism
    448846 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    448846 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    448846 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    448846 (EHHADH)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     448846 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     448846 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     448846 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 2-Hacid_dh_C TrkA_N F420_oxidored Asp_Glu_race ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 448846
NCBI-ProteinID: XP_020925638
Position
13
AA seq 723 aa AA seqDB search
MAEFTRLQNALALLRLRNPPVNALSVSVLHGIKEGLQKALTDHTVKAIVICGTDGIFSAG
ADIHGFSAHKTSDLTLGDIVDKIQRYEKPVVAAIQGLALGGGLELALGCHYRIAHAEAQV
GFPEVTLGILPGARGTQLLPRLIGVPAALDLITSGRHISANEARKLGILDEVVNSDPVEE
AIRFAQRVLDQTLESRRICNKSVQSLSNMDTIFSEALLKMRKQYPGCLAQETCVRAVQAA
VQYPYETGIKKEEELFMYLQKSGQARALQYAFLAERSANKWSTPSGASWKTASAQPISSV
GILGLGTMGRGIAVSFAKAKIPVIAVEPDKKQLENANKIITSLLEKEASKMQQSGHPWSG
PKPRLTTSMKELSGVDLVIEAVFEEMNLKKQVFAELSAVCKPQAFLCTNTSALDIDEIAS
STNRPHLVIGTHFFSPAHVMKLLEVIPSRYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLKPYYDQTYFLLEDGSMPEEIDQVLEEFGFRMGPFRVSDLAGLDIGWKSRKGQGLT
GPALPPGTSARKRGNQRYCPVPDMLCELGRFGQKTGKGWYLYDKPLGRIHKPDPWFSKFL
TQYRETHHIEPRVISRDEILDRCLYSLINEAFRILEDGIAATPEHIDVVYLHGYGWPRHR
GGPMFYASTVGLPTVLEKLQKYHRQNPDIPQLEPCDYLKKLASQGNPPLKEWQSLAGPPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtttacgcggctgcagaacgccctggcgctgcttcgcctacgaaacccgccg
gtcaacgctctcagtgtgtctgtactccatggaataaaagaggggttgcagaaagctcta
acagatcatacagtaaaagccattgtgatttgtggaacagatggcatcttctctgcaggt
gccgatatccatggcttcagcgctcataaaacctctgacttaacactgggagatatagta
gataaaatacagagatatgagaagcctgtggtggctgctatccaaggcttggctttagga
ggaggactggagctggccctgggctgtcactataggattgcccatgcagaggctcaagtt
ggctttccagaagtcacacttggaatccttcctggtgcaagaggaacccagcttctcccc
agacttattggagttcctgctgcacttgacttaattacctcaggaagacatatttcagca
aatgaagcccgtaagctgggtattctagatgaagttgtgaactcagacccagttgaagaa
gcaatcagatttgcccagagagttttagatcaaactctagaatcccgtagaatctgcaat
aagtcagttcagagcttgtccaacatggacaccattttcagtgaagcccttttgaagatg
cgaaagcagtaccctgggtgccttgctcaggagacttgcgtccgtgcagtccaggccgct
gtccaatatccctatgagacgggcatcaagaaggaagaggagctgtttatgtaccttcag
aaatcagggcaggctagagccctgcaatatgctttcttggcggagaggagtgcaaataag
tggtccactccctctggagcatcctggaaaacagcatcggcacagcccatctcctctgtt
ggcattctcggcttgggaacgatgggccgaggcattgctgtttcttttgcaaaggccaaa
atccccgtgattgctgtagaaccagacaagaagcaactagagaatgccaacaagataata
acctccctcttggaaaaggaagcatccaaaatgcagcagagtggccatccttggtcagga
ccaaaacccaggttaactacatctatgaaagagcttagtggtgtagatttagtcattgaa
gcagtatttgaggaaatgaacctgaagaaacaggtctttgctgaactgtcagccgtgtgc
aagccacaagcatttttgtgcaccaatacttccgccctggacattgatgaaattgcttct
tccaccaatcgtcctcacttagtcattggcacccacttcttctcaccagctcatgtgatg
aagttgttagaggttattcccagccgatactcttcccccactaccattgccactgttatg
aatttatcaaaaaagattaagaaaattggagtagttgtaggcaactgttttggatttgtt
ggaaatcgaatgttgaagccttattatgatcagacatatttcttattagaagatggcagt
atgccagaggagatagatcaggtgctggaagagtttggtttcagaatgggaccttttaga
gtatctgatcttgctgggttggatataggttggaaatctcggaaagggcaaggtcttact
ggacctgcattgcctccaggaacttctgcccgaaagcgaggcaaccagaggtactgccca
gttcctgatatgctctgtgaattgggacggtttggccagaagacaggtaagggttggtac
ctttatgataagccattgggtaggattcacaaacctgatccctggttttccaaatttctg
acacagtacagagaaacccatcacattgaaccacgtgtcattagccgggatgagatcctt
gaccgctgcttatattcactcatcaatgaagcattccgcatcctggaagatgggatagca
gctaccccagagcacattgatgtggtctatttacacgggtatggatggccaaggcacagg
ggtgggcctatgttctatgcttccacagttgggttgcccacagtgctagagaagttgcag
aaatatcacaggcagaatcctgatattccccaactagagccttgtgactatctgaaaaaa
ctggcttcccagggaaaccctcccctgaaagaatggcaaagcttggcaggaccccccagc
agtaagttgtga

DBGET integrated database retrieval system