KEGG   Sus scrofa (pig): 494016
Entry
494016            CDS       T01009                                 

Gene name
CA3
Definition
(RefSeq) carbonic anhydrase 3
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00910  Nitrogen metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    494016 (CA3)
Enzymes [BR:ssc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     494016 (CA3)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 494016
NCBI-ProteinID: NP_001008688
Ensembl: ENSSSCG00000006141
UniProt: Q5S1S4
Position
4
AA seq 260 aa
MAKEWGYADHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLLPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLTAAYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNSKYNSFATALKHPDGVAVVGIFLKIGREKGEFQLVLDALDKIKTKGKEAPFTNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQMAKLRSLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaaggagtggggctacgccgaccacaatggtcctgaccactggcatgaactttac
ccaattgccaagggagacaaccaatcgcccattgaactgcacactaaggacatcaagcac
gacccttctctgctgccctggacagcatcttatgaccctggctctgccaagaccatcctg
aacaatgggaagacctgcagggttgtatttgatgatacttatgacaggtcaatgctgaga
ggtggtcctctcactgcagcctaccggcttcgccagtttcatcttcactggggctcctca
gatgatcacggatctgagcacactgtggatggagtcaagtatgctgcggagctccatttg
gttcattggaattcaaagtataacagttttgcaactgctctgaagcaccctgatggagtg
gctgtagttggcatttttctgaagataggacgtgagaaaggcgagttccaactagtcctt
gatgcattggacaaaattaagacaaagggcaaggaggcacccttcacgaacttcaaccca
tcctgcctgttccctgcctgccgggactactggacctaccatggctccttcaccacgccg
ccctgcgaggagtgcattgtgtggctcctgctgaaggagcccatcaccgtgagctctgac
cagatggccaagctgcgaagcctctactccagtgcggagaacgagccccctgtcccccta
gtgaggaactggcgccccccacagcctatcaagggcaggatagtgaaggcctccttcaaa
tga

DBGET integrated database retrieval system