KEGG   Sus scrofa (pig): 503544Help
Entry
503544            CDS       T01009                                 

Gene name
DECR1
Definition
(RefSeq) 2,4-dienoyl-CoA reductase, mitochondrial
  KO
K13236  2,4-dienoyl-CoA reductase, mitochondrial [EC:1.3.1.34]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    503544 (DECR1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.34  2,4-dienoyl-CoA reductase (NADPH)
     503544 (DECR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Polysacc_synt_2 Epimerase GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 503544
NCBI-ProteinID: NP_001177161
Ensembl: ENSSSCG00000006126
UniProt: Q6XGY2 Q95JB5 D6QST6 A0A5K1U5Q1
Position
4
AA seq 328 aa AA seqDB search
MALLGRVFAPGHGPRRFFTYGTKILYQSTEAFPSKSFPPFQKVMLPPNTFQGKVAFITGG
GTGIGKRMTTHLSSLGAQCVIASRNIDILKATAEEISSQTGNKVHAIQCDVRDPNMVQNT
VSELIKVIGHPDIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQ
KGAAFLAITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWSKYGMRFNVIQPGPIKTKG
AFSRLDPTGAFEKEMIDRIPCGRLGTVEELANLATFLCSDYASWINGATIRFDGGEQVLL
SGEFNHLRKVTKEQWDTIEGLIRKTKGS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctaggccgggttttcgcccctggacacggtcctcggcggtttttcacttat
ggaacaaaaatattgtatcaaagcactgaagcttttccgtctaagtccttcccacccttt
caaaaagtgatgctgccaccaaatacttttcaaggaaaagtagcattcattaccggggga
ggaactggcattggtaaaagaatgacaactcatctgtccagcttaggtgcacagtgtgtg
atagccagccgaaatattgacattttgaaagctactgcggaagaaatttcttctcaaact
ggaaataaggttcatgcaattcagtgtgatgtgagggatcctaatatggtgcagaacact
gtgtcagaactgatcaaagtcataggacatcctgatattgtgataaacaatgcagcagga
aattttatctcccccactgaaagactctctcctaatgcctggaagaccataactgacata
gttctaaatggtacagcatttgtgacactagaaattgggaagcaactaattaaagcacag
aaaggagcagcatttcttgctattacaaccatctatgccgagactgggtcaggttttgtg
gtaccaagtgcttctgccaaagcaggagtggaagccatgagcaagtctcttgcagctgaa
tggagtaaatatggaatgcgattcaatgtgattcaaccagggcctataaaaaccaagggt
gcttttagccgtcttgacccaactggagcatttgagaaagaaatgattgacagaattccc
tgtggtcggctaggaactgtggaagaacttgcaaatcttgctactttcctttgcagtgat
tatgcttcttggattaatggagctacaattagatttgatggtggggagcaagtactactt
tcaggggaattcaaccatctgcggaaggttaccaaggaacagtgggatacaatagaagga
ctcatcaggaagacaaaaggctcctaa

DBGET integrated database retrieval system