KEGG   Sus scrofa (pig): 574052Help
Entry
574052            CDS       T01009                                 

Gene name
CETN3
Definition
(RefSeq) centrin-3
  KO
K16466  centrin-3
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ssc03019]
    574052 (CETN3)
   03036 Chromosome and associated proteins [BR:ssc03036]
    574052 (CETN3)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     574052 (CETN3)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    574052 (CETN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_4 Caleosin EF-hand_14 SPARC_Ca_bdg MgtE_N Relaxase
Motif
Other DBs
NCBI-GeneID: 574052
NCBI-ProteinID: XP_003123825
Ensembl: ENSSSCG00000014151
UniProt: F1RNZ4 A0A287B8A1 A0A4X1TDU6
Position
2
AA seq 167 aa AA seqDB search
MSLALRNELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFD
VKKADILKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISL
RNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagctctgagaaatgagcttgtagtagacaaaacaaaaaggaaaaaaagaaga
gaactctctgaagaacagaaacaagaaattaaagatgcttttgaactatttgacacggac
aaagatgaagcaatagattaccatgaattaaaggtggcaatgagagccttggggtttgat
gtaaaaaaagctgatatactgaagattcttaaagattatgacagagaagccacggggaaa
atcacctttgaagattttaatgaagttgtgacagactggatattggaaagagatccacat
gaagaaatattgaaggcatttaaattatttgatgatgatgattcaggtaaaataagcttg
aggaatttgcgacgtgttgccagagaattgggtgaaaacatgagtgatgaagaacttcgg
gctatgatagaagaatttgataaagatggtgatggagaaataaatcaagaggaattcatt
gctattatgactggtgacatttaa

DBGET integrated database retrieval system