KEGG   Sus scrofa (pig): 595105Help
Entry
595105            CDS       T01009                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04217  Necroptosis
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04668  TNF signaling pathway
ssc04932  Non-alcoholic fatty liver disease (NAFLD)
ssc05010  Alzheimer disease
ssc05016  Huntington disease
ssc05132  Salmonella infection
ssc05134  Legionellosis
ssc05142  Chagas disease (American trypanosomiasis)
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    595105 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    595105 (CASP8)
   04215 Apoptosis - multiple species
    595105 (CASP8)
   04217 Necroptosis
    595105 (CASP8)
   04115 p53 signaling pathway
    595105 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    595105 (CASP8)
   04621 NOD-like receptor signaling pathway
    595105 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    595105 (CASP8)
   04625 C-type lectin receptor signaling pathway
    595105 (CASP8)
   04657 IL-17 signaling pathway
    595105 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    595105 (CASP8)
   05203 Viral carcinogenesis
    595105 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    595105 (CASP8)
   05016 Huntington disease
    595105 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    595105 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    595105 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    595105 (CASP8)
   05134 Legionellosis
    595105 (CASP8)
   05152 Tuberculosis
    595105 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    595105 (CASP8)
   05162 Measles
    595105 (CASP8)
   05164 Influenza A
    595105 (CASP8)
   05161 Hepatitis B
    595105 (CASP8)
   05160 Hepatitis C
    595105 (CASP8)
   05168 Herpes simplex virus 1 infection
    595105 (CASP8)
   05163 Human cytomegalovirus infection
    595105 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    595105 (CASP8)
   05169 Epstein-Barr virus infection
    595105 (CASP8)
   05165 Human papillomavirus infection
    595105 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    595105 (CASP8)
   05142 Chagas disease (American trypanosomiasis)
    595105 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    595105 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    595105 (CASP8)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     595105 (CASP8)
Peptidases and inhibitors [BR:ssc01002]
 Cysteine peptidases
  Family C14: caspase family
   595105 (CASP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED DUF1912
Motif
Other DBs
NCBI-GeneID: 595105
NCBI-ProteinID: NP_001026949
UniProt: A0A4X1V6R2 Q56VC3
Position
15
AA seq 486 aa AA seqDB search
MNFNRCLYNIGEHLDSDDLASLKFLSLDYIPHRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRMNRLDLLINYLETNEEEMESELRIPGRAQISAYRVMLFQISENVTRSELKDF
KFFLSQEIAKCKLDDDMTLLDMFIEMEKRAILGERNLETLKRICEQINKALLKKICDYEE
LNKDRRMSLESASDEFSNDMSQLVIQEGSLGELAMSDCLGEQDSDSEASEAVYRMKSKPR
GYCLIFNNYDFSVARKNIARLHNIKDRNGTDLDAAALSKTFSDLHFEVRPYKDVTAKEIC
DVLEYYRNLDHNDKDCFVCCILSHGDKGIIYGSDGREAPIYDLTSYFTGSKCPSLLGKPK
IFFIQACQGDKYQKGIAIETDSEQTEAYLEMDSSLQKRYIPDEADFLLGMATVNNCVSYR
STMEGTWYIQSLCQSLKERCPRGEDILTILTKVNFEVSNKDDKKNMGKQMPQPTFTLRKK
LFFPLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaacagatgtctctataatattggggaacatttggacagtgatgacctggct
tccctcaagttcctgagcctggactacatcccacataggaagcaggaacccatcaaagat
gctctgatgttattccagaggctccaagaaaagagaatgttggaggaaagcaacttgtcc
ttcttgaaggaactgcttttccgaatgaatagactggatcttctgatcaattacctggaa
accaatgaggaggagatggagagtgagcttcggataccaggcagggcccagatctctgcc
tacagggtcatgctttttcagatttccgaaaatgtgaccaggtcggaattgaaggacttt
aagttttttttgagtcaggagattgccaaatgtaaactggatgatgacatgaccttgctt
gatatgtttatagagatggagaagagggccatcctaggggaaagaaatttggagactctg
aaaagaatctgtgaacaaatcaacaaggccctgctgaagaaaatctgtgattatgaagaa
ttaaacaaagatcgaagaatgagccttgaaagtgcttcggatgaattttcaaatgatatg
tctcaactggtgatccaggaggggtccctgggagagctggccatgtcggactgtctggga
gaacaggacagtgattcagaggcatcagaagcagtttaccgaatgaaaagcaagcctcgg
ggatactgtttgatcttcaacaattatgattttagtgtagcacggaagaatatagccaga
cttcacaacattaaggatagaaatggaacagacttggatgcagcggctctgagcaagacc
tttagtgatcttcattttgaagtaaggccttacaaagatgtcacagcaaaggaaatctgt
gatgttctggaatactaccgaaacttggaccataatgacaaagactgctttgtctgctgc
atcctctcccatggagacaagggcatcatctacggctctgatgggagggaagcccccatc
tatgatctgacctcttatttcactggttcgaagtgcccttcccttcttggtaaacccaaa
atttttttcattcaggcttgtcaaggggataaataccagaaaggtatagctattgagaca
gactcagaacagacagaagcctatttagaaatggattcatcacttcagaagagatatatc
ccagacgaggcggacttcctgctggggatggccactgtgaacaactgtgtttcttaccga
agcaccatggaggggacctggtatatccaatcactgtgccagagcctgaaagaaagatgt
cccaggggtgaagatattcttaccatcctcaccaaggtgaactttgaagtaagcaataag
gatgataagaagaatatgggcaaacagatgccacaacctactttcaccctgagaaaaaaa
ctcttctttcctcttaattaa

DBGET integrated database retrieval system