KEGG   Sus scrofa (pig): 595117
Entry
595117            CDS       T01009                                 

Gene name
RAB11A
Definition
(RefSeq) ras-related protein Rab-11A
  KO
K07904  Ras-related protein Rab-11A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04962  Vasopressin-regulated water reabsorption
ssc04972  Pancreatic secretion
ssc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    595117 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    595117 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    595117 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    595117 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    595117 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    595117 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    595117 (RAB11A)
   04031 GTP-binding proteins [BR:ssc04031]
    595117 (RAB11A)
Membrane trafficking [BR:ssc04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    595117 (RAB11A)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   595117 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   595117 (RAB11A)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    595117 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 595117
NCBI-ProteinID: NP_001026958
Ensembl: ENSSSCG00000022696
UniProt: Q52NJ1
Position
1
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatcttgaaagc
aagagcaccattggcgtagagtttgcaacaagaagcatccaggttgatgggaaaacaata
aaggcacagatatgggacacagcagggcaagagcgataccgagctataacatcagcatac
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtggaacgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatttgcgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgagacatctgctttagactctacaaat
gtagaagctgcttttcagacaatcttgacagagatataccgcattgtttcccagaagcaa
atgtcagacagacgtgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

DBGET integrated database retrieval system