KEGG   Sus scrofa (pig): 606748
Entry
606748            CDS       T01009                                 

Gene name
SLC45A2
Definition
(RefSeq) membrane-associated transporter protein
  KO
K15378  solute carrier family 45, member 1/2/4
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    606748 (SLC45A2)
Transporters [BR:ssc02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   606748 (SLC45A2)
SSDB
Motif
Pfam: MFS_1 MFS_2 Abhydrolase_9_N
Other DBs
NCBI-GeneID: 606748
NCBI-ProteinID: XP_003483856
Ensembl: ENSSSCG00000016821
UniProt: A0A5G2R2W6
Position
16
AA seq 532 aa
MDESSGQPDVHTYKSLAEDGPFCSVEPPKRPTGSLVMHSMAMFGREFCYAVEAAYVTPVL
LSVGLPKSLYSVVWLLSPVLGFLLQPVVGSASDHCRARWGRRRPYILALGVMMLLGMALY
LNGDTIISALIADPRRKPIWAISITMTGVVLFDFAADFIDGPIKAYLFDVCTHQDKERGL
HYHALFTGLGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSSLVLTLCFIIHLCSIPEA
PLRDTAKDTPPRQAPQDPASSSDRMYEYGSIEKVKNSYVNPELALQGGKTKNPPAEQTQR
TMTIKSLLRALMSMPAHYRCLCISHLIGWTAFLSNMLFFTDFMGQIVYHGDPYSAHNSTE
FLIYQRGVEVGCWGLCINSVFSSLYSYFQKALVPYVGLKGLYFMGYLLFGLGTGFIGLFP
NVYSTLVMCTSFGVMSSTLYTVPFNLIAMYHREEQEEQRQQAQGGGLDSSRRGQGLDCAA
LTCMVQLAQILVGGGLGFLVNVVGSVVVVVITASAAALIGCCFVALFVRYID
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggacgagagcagcgggcagcctgacgtccacacctataaatccctagccgaggatggc
cctttctgctctgtggagccgcccaaaagacccacggggagtctggtcatgcacagcatg
gccatgttcggccgggagttttgctatgcggtggaggcggcctacgtgaccccagtcctg
ctcagtgtgggcctgcccaagagtctgtacagcgtggtgtggctcctcagccccgtcctg
gggttcctgctgcagccggtggtgggatcggccagcgaccactgccgggcccggtggggc
cggcggagaccctacatcctcgctctgggtgtcatgatgctcttgggcatggctctgtac
ctcaacggggacactatcatatcagctttgattgctgacccaaggaggaagccgatttgg
gccataagcatcaccatgacaggtgtggttctttttgattttgctgctgacttcattgat
gggcccatcaaagcctacttatttgatgtctgcacccatcaggacaaggagaggggcctc
cactatcatgccctcttcacaggtttgggcggtgccctgggttaccttttgggtgccatc
gactgggcccatctggaactgggaagattgctgggcacagaattccaggtcatgttcttc
ttctcctccttggtgctcactttgtgttttattatccatctgtgcagtatccccgaagcc
ccacttagagatactgcaaaggacactcccccacggcaagccccccaggaccctgcatcg
tcatcagacaggatgtacgagtatgggtctattgagaaagttaaaaatagttatgtaaac
ccagagctggcgctgcagggaggaaaaaccaaaaatcctcctgctgaacagactcagagg
acaatgaccataaagtcactgctgagggcactgatgagcatgcctgcccactaccgctgc
ctttgcatcagtcacctcattggatggactgccttcctgtccaacatgctcttcttcaca
gacttcatgggccagattgtgtaccatggggacccctacagtgcacacaactctacagag
ttcctcatctaccaaagaggggtcgaggttgggtgttggggcttgtgcatcaactccgtg
ttttcctcactttactcttactttcagaaagctttggttccctacgtcggattaaagggt
ctttacttcatggggtatttgctgtttggcctggggacgggatttatcgggctcttccca
aatgtctactccaccctggtcatgtgcacctcgtttggcgtgatgtccagcaccctgtac
accgtgccctttaacctcattgccatgtaccaccgcgaggagcaggaggagcagaggcag
caggcccagggcgggggcctggacagcagccggagggggcagggcctggactgcgctgcc
ctcacctgcatggtgcagctggcacagatcctggtcggaggcggcctgggctttctggtc
aacgtggtcgggagcgtcgtcgtcgtggtgatcacggcctctgcggcggcactgatcggc
tgttgctttgtggctctctttgttagatatatagattag

DBGET integrated database retrieval system