KEGG   Sus scrofa (pig): 654411Help
Entry
654411            CDS       T01009                                 

Gene name
PLIN1
Definition
(RefSeq) perilipin-1
  KO
K08768  perilipin-1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03320  PPAR signaling pathway
ssc04371  Apelin signaling pathway
ssc04714  Thermogenesis
ssc04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    654411 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    654411 (PLIN1)
   03320 PPAR signaling pathway
    654411 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    654411 (PLIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Perilipin
Motif
Other DBs
NCBI-GeneID: 654411
NCBI-ProteinID: NP_001033727
Ensembl: ENSSSCG00000001844 ENSSSCG00000028360
UniProt: Q2TCH2
Position
7
AA seq 516 aa AA seqDB search
MAINKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEK
GIQSAGSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTI
STRLRSARNSISVPVTSTADKVLGAALAGCELAWGMAKDTAEYAANTRAGRLASGGADLA
LGGVEKVVEPLLPPAKEESASAPGHQHGQKPPKAKPSLVSRVGTLASTISQHTFQATSRA
LKQGHALAMWIPGVAPLSSLAQWGASAAMQVVSRRQSVVRVPWLHNLAATQEEDHDDQTD
TEGEEMEEEAEPETEENKLSEGAALPGPQGFLGKAVHTLQRALQSTISLVTWAPATALGT
AGRMLPFTPARAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID
NPPPEAERRETERRGSGALPAAPEAAPRPAPTRGSLRSARGPGAEDRGDTAAALRPAFPA
VPREKPARRVSDSFFRPSVMEPILGRAQYNQLRKKS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaacaagggcctgactttgctggatggagatctccctgagcaggagaacgtg
ctgcagcgggtcctgcagctaccggtggtgagcggcacctgtgagtgcttccagaagacc
tacaccagcaccaaggaagcgcaccccctggtggcgtctgtatgcaatgcttacgagaag
ggcatccagagcgctggcagcctggccgcctggagcatggagccagtggtccgcaggctg
tccacccagttcacagctgccaatgagctggcctgccgaggcctggaccacctggaagaa
aagataccggccctccagtatcctcctgaaaagatcgcctctgagctgaaggacacaatc
tccacccgcctccgcagtgccaggaacagcatcagcgtgcccgtcaccagcactgcagac
aaagtcctcggtgctgctctggctggctgcgagctcgcttgggggatggccaaagacact
gctgaatatgccgccaacacccgagccggccgactggcctctgggggtgccgacttggcc
ttggggggtgttgagaaggtggtagagcccctcctccctccagccaaggaagagtcagcc
tccgctccaggacaccagcatggccagaagcctcccaaggccaagccgagcctcgtgagc
agggttggaaccctggccagcaccatctctcaacacaccttccaggccacgtctcgcgct
ctgaaacagggccacgccctggccatgtggatccccggtgtggcacccctgagcagcctg
gcccagtggggtgcatcagcggccatgcaggtggtgtcccggcggcagagcgtggtgcgg
gtgccctggctgcacaacctggcggccacccaggaggaggatcacgatgaccagacggac
acagagggggaggagatggaggaggaggcggaaccagagacagaggagaataagctcagt
gagggagcagccctgcctggcccgcaaggcttcctgggcaaagcggtgcacaccctgcag
agagcgctccagagcacgatctccctcgtgacttgggcacctgcgactgcgctgggcacc
gctgggaggatgctgcccttcacgccggctcgcgctgtctcctcgaccaaggggagggcc
atgtccttgtctgacgccctgaagggcgttactgacaacgtggtggacacggtggtgcac
tacgtgccgctccccaggctgtcgctgatggagcccgagagcgagttccgggacatcgac
aacccgccgccagaggccgagcgccgggagacggagcgcagggggtccggggcgctgccc
gccgccccggaagccgcgccgcgccccgcgccgacccgcggcagcctgcgcagcgctcgg
ggccctggcgccgaagaccggggggacaccgctgccgcgctgcgccccgccttcccggca
gtgccccgcgagaagccggcgcgcagggtaagcgacagcttcttccggcccagcgtcatg
gagcccatcctgggccgcgcgcagtacaaccagctgcgcaagaagagctga

DBGET integrated database retrieval system