KEGG   Sus scrofa (pig): 654416
Entry
654416            CDS       T01009                                 

Gene name
PEG10
Definition
(RefSeq) retrotransposon-derived protein PEG10 isoform 4
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: Retrotrans_gag DUF4939 KASH_CCD zf-CCHC_5 Spc7 zf-CCHC CCDC106 Uso1_p115_C V_ATPase_I YabA DUF1664 CAMP_factor UPF0242 eIF3g SHE3 DUF4795 DUF5798 CENP-H Rootletin TolA_bind_tri TMF_DNA_bd ERM ZapB
Other DBs
NCBI-GeneID: 654416
NCBI-ProteinID: NP_001103414
UniProt: Q0PR72 Q2MJT3 A0A287AGL8
Position
9
AA seq 403 aa
MRNKKLLKTKRRKGGRGGQEPGLHPHRSEATPGRSPPTPSLTLGPDCPPPPPPPPPNDPS
SSNSSSPCGGQRGQYNPNLAERRRDDLSEEINNLREKVMKQSEENNNLQNQVQKLTEENT
SLREQVEPAPEEEEDDIELCGAAAAAAPATPIEEECSEDLPEKFDGNPDALVPFMAQCQL
FMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMTEMKHVFEDPQ
RREAAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGLSDHIQAELSRLE
VAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVMPHVSNHHQVDPTEPVGGARMRLT
QEEKERRRKLNLCLYCGNGGHYADNCPAKASKASPAGNSPAPL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcgaaacaaaaagcttctgaaaaccaaaaggcgaaagggcggaagaggaggccaggag
ccaggcctccatccccacaggagtgaagctacacctgggaggtctcctcccaccccatct
ctcaccctggggcccgactgcccaccacctcctcctcctcctccccccaacgacccatcc
tcctccaactcctcctccccttgcggaggccagaggggccagtacaaccccaatctggca
gagcgaaggcgggacgatctctccgaagagatcaacaacctcagagagaaggtcatgaag
cagtccgaggagaacaacaacctgcagaaccaggtgcagaaactcacagaggagaacacc
tccctccgtgagcaagtggagcccgcccctgaggaagaggaagacgacattgagctgtgc
ggtgctgcagctgctgctgccccagccacgcccatcgaggaagagtgctcagaagacctt
cctgagaaatttgacggcaacccagacgcgctggttcctttcatggcccagtgccagctc
ttcatggaaaagagcacccgagatttctccgtcgatcgcgtccgcgtctgcttcgtgaca
agcatgatgaccggccgtgctgcccgctgggcctccgccaagctagagcgatcccactac
ctgatgcacaactacccagccttcatgaccgaaatgaagcacgtctttgaagaccctcag
cgccgcgaggctgccaaacgcaaaatcagacgtctgcgccaaggcatggggtcagtcatc
gactattccaacgcgttccagatgattgcacaggatctggattggaacgagcctgcactg
attgatcagtaccacgagggcctcagtgaccacattcaggcagagctgtcccgccttgaa
gtcgccaagtcgctgtccgccctgatcggccagtgcatccacatcgagagacggctggcc
agggctgccgccgcgcgcaagccacgctccccaccacgtgcgctggtgatgcctcatgtc
agcaaccaccaccaggtggatcccaccgagcccgtgggaggtgcccgcatgcgcctgacc
caagaagaaaaagaaagacgcagaaagctgaacctgtgcctctactgtgggaatggaggt
cactacgccgacaactgtcctgccaaggcctcgaaggcttcgccggcgggaaactccccg
gccccgctgtag

DBGET integrated database retrieval system