KEGG   Sus scrofa (pig): 733634Help
Entry
733634            CDS       T01009                                 

Gene name
AKR1C1
Definition
(RefSeq) aldo-keto reductase family 1 member C1
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00140  Steroid hormone biosynthesis
ssc00590  Arachidonic acid metabolism
ssc00790  Folate biosynthesis
ssc01100  Metabolic pathways
ssc04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    733634 (AKR1C1)
   00590 Arachidonic acid metabolism
    733634 (AKR1C1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    733634 (AKR1C1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    733634 (AKR1C1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     733634 (AKR1C1)
    1.1.1.188  prostaglandin-F synthase
     733634 (AKR1C1)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     733634 (AKR1C1)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     733634 (AKR1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 733634
NCBI-ProteinID: NP_001038034
Ensembl: ENSSSCG00000011147
UniProt: Q1KLB4
Position
10
AA seq 337 aa AA seqDB search
MDPKSQRLRLNDGHFIPVLGFGTYAPEEVPKSEALEATKYAIEVGFRHIDSAYLYQNEEQ
VGQAIRSKIADGTVKREDIFYTSKLWATFLRPELVRPALEKSLKNLQLDYVDLYIIHFPV
ALKPGEELLPTDENGKALFDTVDLCRTWEALEKCKDAGLTKSIGVSNFNHQQLERILNKP
GLKYKPVCNQVECHPYLNQSKLLDFCKSRDIIPVAYSALGSQRVKGWVNLNHPVLLEDPV
LHAIAKKHKQTSAVIALRYQLQRGVVVLAKSYNKRRIKENLQVFNFELPPEDMKTIDGLN
QNLRYCDFSYAVGHPDYPFRPRVTHHVFYQNIMLPEL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaaagccagcgtcttcggcttaacgatggtcacttcattcctgtactggga
tttggtacctatgcacctgaagaggttcccaagagtgaagctctggaggccaccaaatat
gccatagaagttgggttccgtcatatcgatagtgcttatttataccaaaatgaagagcag
gttggacaggccattcgaagcaagattgcagatggcaccgtgaagagagaagacatattc
tacacgtcaaagctttgggccactttccttcgaccagagttggtccgaccagccttggaa
aagtccctgaagaatctccaactggactatgtggatctctatattattcattttccagtg
gctctgaagcccggggaggaacttctgccaacagatgaaaacggaaaagcactatttgac
acagtggatctctgtcgcacgtgggaggccttggagaagtgtaaggacgcaggactgacc
aagtccatcggcgtgtccaactttaaccaccaacagctggagaggatcctgaacaagcca
gggctcaagtacaagcccgtctgcaaccaggtggaatgtcatccttacctcaaccagagc
aagctgttggatttctgcaagtcaagagatatcattccagttgcctattctgctctggga
tcccaaagagtaaaaggatgggtgaacctaaaccacccagttctcttggaagacccagtt
cttcatgccattgctaaaaagcacaagcaaacctcagccgtaattgcccttcgctaccag
ctgcagcgcggagttgtggtcctggccaagagttacaataagaggcggatcaaagaaaac
ctgcaggtttttaactttgaattgcctccagaagatatgaaaacaatcgatggcctcaac
caaaatttaagatactgtgatttttcgtatgccgttggtcaccctgactatccatttcga
ccacgagttactcatcatgtattctaccagaacatcatgcttccagagctgtga

DBGET integrated database retrieval system