KEGG   Sus scrofa (pig): 733694
Entry
733694            CDS       T01009                                 

Gene name
AKR1C1
Definition
(RefSeq) aldo-keto reductase family 1 member C1
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00140  Steroid hormone biosynthesis
ssc00590  Arachidonic acid metabolism
ssc00790  Folate biosynthesis
ssc01100  Metabolic pathways
ssc04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    733694 (AKR1C1)
   00590 Arachidonic acid metabolism
    733694 (AKR1C1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    733694 (AKR1C1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    733694 (AKR1C1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     733694 (AKR1C1)
    1.1.1.188  prostaglandin-F synthase
     733694 (AKR1C1)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     733694 (AKR1C1)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     733694 (AKR1C1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 733694
NCBI-ProteinID: NP_001038083
Ensembl: ENSSSCG00000023446 ENSSSCG00000030447
UniProt: Q1KLB2
Position
10
AA seq 324 aa
MMSQMRHFSLKMNDGHTIPMLGLGTSAPSQVLKSETEMAIKRAIDIGYRHIDSAHLYQNE
EEIGRAIQMKIADGTVKRDDIFHTTKVWGTFFRPELVQTNLERSLKKLQMSYVDLYLLHH
PEALQAGEDFFPKDTHGNIIFDTVDLCTTWEAMEKCKNEGLTRSIGVSNFNCKQLERILN
KPGLKYKPVCNQVECHPYLNQSKLLEFCRSHDILLVAYATLGSDARKKWVIKNKPSLLQD
PVLNAIAEKHRRTPAQVALRYQLQRGVVALAKSFSEQRIKENFQVFEFELTPEDMESLDG
LNRNMCYLQDLFSGHTDDASYGND
NT seq 975 nt   +upstreamnt  +downstreamnt
atgatgagtcaaatgagacacttttctttaaagatgaatgatggacacaccatacctatg
ctgggattgggcacttcggctccttctcaggttcttaagagtgagacagaaatggccatc
aagagagcaatcgacataggctaccgccatattgactcagctcatttgtaccaaaatgaa
gaggaaattgggagagccattcagatgaaaattgcagatggcactgtgaagagagatgac
atcttccacactacgaaggtgtggggcacctttttccgtccagaattggtccaaactaat
ctggaaaggtcgctgaagaaacttcagatgagctatgtggatctttatctacttcatcac
ccagaagctttgcaggctggggaggactttttcccaaaggacacccatggaaacatcatt
tttgacacagtggatctctgtaccacgtgggaggccatggagaagtgcaagaacgaggga
ctgaccaggtccatcggtgtgtccaactttaactgcaagcagctggagaggatcttgaac
aagccagggctcaagtacaagcccgtctgcaaccaggtggagtgtcacccttacttaaac
cagagcaaactcctggaattctgccgttcccacgacattctccttgttgcatatgctact
ttggggtctgatgcaaggaagaaatgggtgatcaagaacaaaccaagtctcctgcaggac
ccagtactcaatgccattgctgaaaagcacaggcgaactccagcccaggttgccctgcgc
taccagctgcagcggggggtggtggccctggccaagagcttcagtgagcagaggatcaaa
gagaacttccaggtttttgaattcgagttgaccccagaggatatggaaagcctggacggc
ctaaacagaaacatgtgctatttgcaagatctattttctggtcatacagatgatgcttct
tacggcaatgattaa

DBGET integrated database retrieval system