KEGG   Sus scrofa (pig): 780410
Entry
780410            CDS       T01009                                 

Gene name
PSEN2
Definition
(RefSeq) presenilin-2
  KO
K04522  presenilin 2 [EC:3.4.23.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04330  Notch signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    780410 (PSEN2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    780410 (PSEN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    780410 (PSEN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    780410 (PSEN2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     780410 (PSEN2)
Peptidases and inhibitors [BR:ssc01002]
 Aspartic peptidases
  Family A22: presenilin family
   780410 (PSEN2)
SSDB
Motif
Pfam: Presenilin
Other DBs
NCBI-GeneID: 780410
NCBI-ProteinID: NP_001072134
Ensembl: ENSSSCG00000010860
UniProt: Q0MS45
Position
10
AA seq 448 aa
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGLEDGESAAQWRSQDSEEDHEEDP
DRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLI
YTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLITSSLMLL
FLFTYIYLGEVLKTYNVAMDYPTLFLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMA
LVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLPGYPGEELEEEEERGV
KLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISI
TFGLIFYFSTDNLVRPFMDTLASHQLYI
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctcactttcatggcctctgacagcgaggaagaagtgtgtgacgagcggacgtccctg
atgtcggccgagagccccacgcctcgctcctgccaggaaggcaggcagggcctggaggat
ggagagagtgctgctcagtggagaagccaggacagcgaggaggaccacgaggaagaccct
gaccgctatgtctgcagtggggttcctggccggccaccaggcctggaggaggagctgacc
ctcaaatatggggcaaagcacgtgatcatgctctttgtgcctgtcacgctgtgtatgatc
gtggtagtggccaccatcaagtccgtgcgcttctacacagagaagaatggacagctcatc
tacacgccgttcaccgaggacacgccctccgtgggccagcgcctcctcaactccgtgctc
aacaccctcatcatgatcagcgtcattgtcgtcatgaccatcttcctggtcgtgctctac
aagtaccgctgctacaagttcatccacggctggctgatcacatcctccctgatgctgctc
ttcctcttcacctacatctacctcggggaagtgctcaagacctacaacgtggccatggac
taccccaccctgttcctgaccgtctggaacttcggggcggtgggcatggtgtgcatccac
tggaagggccccctggtgctgcagcaggcctacctcatcatgatcagcgcgctcatggcc
ttggtgttcatcaagtacctcccggagtggtccgcctgggtcatcctgggcgccatctct
gtgtacgatctcgtggctgtgctgtgccccaaagggccgctgagaatgttggtagaaact
gcccaggagagaaacgagcccatatttcctgccctgatatactcatctgccatggtgtgg
acggtaggcatggccaagctggacccctcctctcagggagcccttcagctcccctacgac
ccagagatggaagaggactcctatgacagttttggggagccttcgtaccctgaagtcttt
gaacccccgctgcctggctacccgggcgaggagctggaggaagaggaggaaaggggcgtg
aagctgggcctcggagacttcatcttctacagcgtgctggtgggcaaggcagcggccacg
ggcagcggggactggaacaccacgctggcctgcttcgtggccatcctcatcggtttgtgt
ctgaccctcctgctgctcgcggtgttcaagaaagcgctacccgcccttcccatctccatc
acgttcggcctcatcttctatttctccaccgacaacctggtacggcctttcatggacacg
ctggcctcccaccagctctacatctga

DBGET integrated database retrieval system