KEGG   Staphylococcus schleiferi 1360-13: LH95_08135Help
Entry
LH95_08135        CDS       T04012                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00020  Citrate cycle (TCA cycle)
ssch00620  Pyruvate metabolism
ssch01100  Metabolic pathways
ssch01120  Microbial metabolism in diverse environments
ssch01200  Carbon metabolism
ssch01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LH95_08135
   00620 Pyruvate metabolism
    LH95_08135
Enzymes [BR:ssch01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     LH95_08135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3 Biotin_lipoyl_2 HlyD_D23 GARS_A HlyD_3 GCV_H RnfC_N NQRA ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AKS67419
Position
complement(1715099..1718548)
Genome map
AA seq 1149 aa AA seqDB search
MKRINKLLVANRGEIAIRIFRAATELGIQTVAIYSKEDMSSLHRYKADESYLVGEDLGPS
ESYLNIERIIKVAKDADVDAIHPGYGFLSENMHFAKRCAEEDIIFIGPHLEHLDMFGDKV
KARETAIKAELPVIPGTDGPVDNFERAKAFAEEAGFPLMIKATSGGGGKGMRIVKEASEL
EEAYTRAKSEAEKSFGNSEVYIEKFIDNPKHIEVQIIGDEAGNIIHLYERDCSVQRRHQK
VVEVAPSVSLSTSLRMRICDAAVDLMKKIKYVNAGTVEFLVSGDDFYFIEVNPRVQVEHT
ITEMITGVDIVKTQILIADGESLHDEAIAMPRQDEIHTLGYAIQCRITTEDPTQDFMPDT
GRIVAYRSSGGFGVRLDAGDAFQGAEISPYYDSLLVKVSTHAISYKEAREKMERSLQEMR
IRGVKTNIPFLRNVINHAQFASGDYTTKFLEASPELFVIQPSRDRGTKTLEYIGNVTING
FPNVEKRPKPNFEHPDIPTSDTKAIAQLRGTKQLLDEKGPQAVADWVKAQDEVLLTDTTF
RDAHQSLLATRVRTHDLLKIAPETANVMKDNFSLEMWGGATFDVAYNFLKENPWERLDKL
RKAIPNVLFQMLLRASNAVGYKNYPDNVIQKFVDESAAAGIDVFRIFDSLNWVEQMKVAN
EAVQKAGKISEGTICYTGDILNPKRSNVYTLDYYVKMAQTLEREGFHMLAIKDMAGLLKP
RAAYELIGELKAAVNLPIHLHTHDTSGNGILTYKQAIDAGVDIIDTAVAAMSGLTSQPSS
NSIYYAMSGFERKIRMDIEGHETLSHYWDAVRPYYIDFESDMKSPHTEIYQHEMPGGQYS
NLRQQAKSLGLGERFSEVKDMYRRVNFLFGDIVKVTPSSKVVGDMALYMVQNELNEKDVV
AQGHKLDFPESVVSFFKGEIGQPVNGFNKDLQRVILKGQAPLTERPGEYLEPIDFDALRE
ELQEKQQEKVTEQDLISYALYPKVYEQYVKTYEQFGNVAILDTPTFFFGMRDNEKIEIEI
DKGKILIIQLKTITNPDENGVRTVFFDMNGQARRIQVKDENIQASHLAKPKADKADSSHI
GAQMPGTIIEVKVAEGEQVEAGQSLIISEAMKMETTIQAPFKGTIKKVHVSANDSIESQD
LLIEIEAES
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcaataagctattagtagctaatcgtggtgaaattgctattcgtattttc
cgagcggcgacagagttaggcattcagacggttgcaatatattcaaaagaagacatgagt
tcattacatagatacaaagcagacgaatcgtatttagttggcgaagatcttgggccatca
gaaagttatttaaatattgaacgcatcattaaagtggcaaaagatgcagatgttgatgct
attcatccgggttatggcttcctaagtgaaaatatgcattttgcaaaacgatgtgctgaa
gaagatattatcttcattggaccgcacctcgaacatttagatatgtttggtgacaaagtc
aaagcccgtgaaacagccattaaagcagagctacccgtgataccgggaacagatggcccg
gttgacaattttgaacgagctaaagcatttgcggaagaagcaggcttcccgttaatgatt
aaagcgacaagcggtggtggcggtaaagggatgagaattgtaaaagaagcatcagaactt
gaagaagcctatacacgtgccaagtccgaagcagaaaagtcatttggtaatagtgaagtt
tacattgaaaaatttattgataatccaaaacacattgaagtacaaatcattggtgatgaa
gcaggcaatatcattcatttatatgaaagagactgctcagtccaacgtcgtcatcaaaaa
gtggtagaggtggcaccttctgtaagtttatcgacgtcattaagaatgcgtatttgtgat
gcggcagtcgatttaatgaaaaagattaaatatgtcaacgcgggaaccgttgaattttta
gtttctggtgacgatttttactttatagaagtaaacccacgcgttcaagttgagcatacg
attactgaaatgattacaggtgttgatattgttaaaacacaaattttgattgctgacggt
gagtctctacatgatgaagcgattgcaatgccccgccaagatgagattcatactttaggt
tatgcaatacaatgtcgaatcacgactgaagatcctactcaagattttatgcctgatacg
ggtcgcatcgtagcttatcgctcaagtggtggttttggtgttcgtttagatgcaggtgat
gcattccaaggtgcagaaatttcaccttattacgattcattgcttgttaaagtatcaaca
cacgccatcagttataaggaagcacgagaaaagatggagcgctcattacaagaaatgcgt
attaggggtgtaaaaacgaatatcccatttttgcgtaacgtcattaatcatgcccaattt
gcatctggcgattacacaacgaagtttcttgaagcttcaccagagctatttgtgattcaa
ccttcgcgcgacagaggtacaaaaacattagaatatatcggtaatgttacaataaatggt
tttccgaatgtagagaaacgaccaaaaccaaattttgaacaccctgatattcctacttct
gatacgaaagcaattgcccagttaagagggacgaaacagttgttagatgagaaaggtccc
caagctgttgcggattgggttaaagcgcaggatgaagtcctattaacagatacgacgttt
agagatgcgcaccaatctttattagcgacacgcgtgcggacacatgatcttttgaaaatt
gcgcctgaaacagccaatgtgatgaaagacaatttttcacttgaaatgtggggcggtgct
acatttgatgtagcctataactttttgaaagaaaatccgtgggaacgtttagataaatta
agaaaagcgataccgaatgtactatttcaaatgttattacgtgcgtcaaatgctgtagga
tataaaaattatccagacaatgtcattcaaaagtttgttgatgaaagtgctgcagcgggt
attgatgtctttagaatatttgactcactcaactgggtagagcaaatgaaagttgcgaat
gaagcggttcaaaaagcaggcaaaatttcagaagggacgatctgttatacaggcgatatt
ttaaacccaaaacgttcgaatgtttatacgttagattattatgtgaagatggcacagaca
ctcgaaagagaaggcttccatatgttagccattaaagatatggctggtttattaaaaccg
agagctgcatacgaattaattggtgaactgaaggcagcagttaatcttcctattcatttg
catacacatgatacaagtggaaacggcattttaacatacaagcaagctattgatgctggc
gtagatattattgatactgcggttgctgcgatgtcaggtttgacgagtcagccaagtagt
aactcaatttactacgcaatgagtggttttgagcgtaagattcgtatggacatcgaaggt
catgaaacactttctcattattgggatgcagtacgcccatactatattgattttgaaagt
gatatgaaatcgccacatacggaaatttatcaacatgaaatgccaggtggccaatattca
aatcttcgtcaacaagctaaaagcttaggtttaggtgaacgttttagtgaagtgaaagac
atgtaccgtcgcgtgaatttcttatttggtgatattgttaaagtaacgccatcttcaaaa
gttgtcggtgacatggcgctttatatggttcaaaatgagttgaacgaaaaagatgttgtt
gctcaagggcacaaattagattttccagaatctgttgtgtcattttttaaaggtgagatt
gggcaacctgttaatggcttcaataaggatttgcaacgtgttatattgaaaggacaagcg
ccactcactgagcgtcctggtgaatatttagagccaatcgattttgatgcactccgtgaa
gaattgcaagaaaagcaacaagaaaaggtaacagagcaagatctcattagttatgcgcta
tatccaaaagtgtacgagcaatatgttaaaacgtatgagcagtttggtaatgttgctatt
ttagatacaccaacattcttcttcggcatgagagataatgaaaaaatagaaattgagatt
gataaaggtaaaattttaattatccaacttaaaacaattacaaatcctgatgaaaatggt
gtgcgaactgtcttctttgatatgaacggtcaagcgcgtcgtattcaagtgaaagatgaa
aacattcaagcttctcatctagcgaaaccgaaagcggataaagcagattcatcacatatt
ggtgcacagatgccggggacaattatagaagttaaagtagctgaaggtgagcaagttgag
gcaggacagtcattgattattagtgaagctatgaaaatggaaactactattcaagcacct
tttaaaggaacaatcaaaaaagttcatgtttcagcgaatgacagtattgaatctcaagac
ttacttattgagatagaagcagaatcataa

DBGET integrated database retrieval system