KEGG   Staphylococcus schleiferi 1360-13: LH95_10370Help
Entry
LH95_10370        CDS       T04012                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00071  Fatty acid degradation
ssch00280  Valine, leucine and isoleucine degradation
ssch00310  Lysine degradation
ssch00362  Benzoate degradation
ssch00380  Tryptophan metabolism
ssch00620  Pyruvate metabolism
ssch00630  Glyoxylate and dicarboxylate metabolism
ssch00640  Propanoate metabolism
ssch00650  Butanoate metabolism
ssch00900  Terpenoid backbone biosynthesis
ssch01100  Metabolic pathways
ssch01110  Biosynthesis of secondary metabolites
ssch01120  Microbial metabolism in diverse environments
ssch01130  Biosynthesis of antibiotics
ssch01200  Carbon metabolism
ssch01212  Fatty acid metabolism
ssch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH95_10370
   00630 Glyoxylate and dicarboxylate metabolism
    LH95_10370
   00640 Propanoate metabolism
    LH95_10370
   00650 Butanoate metabolism
    LH95_10370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH95_10370
   00072 Synthesis and degradation of ketone bodies
    LH95_10370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH95_10370
   00310 Lysine degradation
    LH95_10370
   00380 Tryptophan metabolism
    LH95_10370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH95_10370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH95_10370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH95_10370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssch04147]
    LH95_10370
Enzymes [BR:ssch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH95_10370
Exosome [BR:ssch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH95_10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKS67839
Position
complement(2183354..2184496)
Genome map
AA seq 380 aa AA seqDB search
MTKAVIVAAKRTPIGVYGGLLKRWEPEALLKPLFEYFVENLPCPLDELDDVIIGNIVGKG
GNIARKSLLEAGIDVSIPGLTVDRQCGSGLEAIHLACRLIESGAGDFYIAGGVESVSRAP
WKMEKPTSLYPSSPPTFYERAPFAPEGQDPSMIEAADNVAKQYHVIREDQDRFAVQSHHR
TSQAIAKGVIEPEILPLSVNGQQMLHDESVKPKIQYERIARLKPLREGGTVTVGNCCLKH
DGACLVVVMSEQKARQLGLTQGLAFVDYAMVGVDPNLLGIGPVPAVKRILEQQQLTIEQI
DAVELNEAFSSQVLASQRELDIRNDQLNRFGGAIAMGHPYSASGAILVTRLFYMMDAHRT
IATMGIGGGMGNAALFERWA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagcagtcattgtagcagcgaaacgcacacccattggcgtttatgggggatta
ttaaaaagatgggaacccgaagcgttattaaaaccattatttgagtattttgtggagaac
ttgccgtgtccgctcgatgaactcgatgatgtaatcattggaaatatcgttggcaaaggg
gggaatattgcacgcaaaagtttattagaagcgggcatcgatgtgtcgattcctggactt
acagttgatcgacaatgtggttcgggtttagaagccattcatttagcatgtcggttgatt
gaaagtggcgcgggagatttttacatcgctggtggcgtagagagtgtgagtcgtgcgccc
tggaaaatggaaaaaccgacatcattatatccttccagtcccccaactttttatgaacgc
gcaccatttgcgccagagggtcaagatccgagtatgattgaagccgccgacaatgtcgca
aaacaataccacgtgataagagaagaccaagatcggtttgcggttcaaagtcatcaccgc
acgagccaagcgatagcgaagggtgtcatagaacctgaaatattaccgctttctgtaaat
ggacaacagatgcttcatgatgaaagtgtaaagccgaaaatccaatatgaacgtatcgca
cgtttaaaaccgctacgtgaaggcggtacggtaacagtcggtaattgttgtcttaaacat
gacggagcatgtttagttgtagtgatgtctgaacaaaaagcacgccaactcggtttgaca
caaggattagcatttgttgattatgcgatggtcggtgttgatcccaatctattagggata
ggtccagttccggcagtaaagcgcattctagaacagcaacaactgacaatcgaacaaatt
gatgctgtggagttaaatgaagcgttcagttcacaagtgcttgcatcacagcgagagcta
gacattcgcaatgaccaactcaatcgttttggcggtgccattgcgatgggacacccttat
agtgcaagcggggccattttagtcactcgattattttatatgatggatgcgcacagaacc
attgctacgatggggattggaggcggtatgggtaatgcagcgttatttgaacgttgggcg
taa

DBGET integrated database retrieval system