KEGG   Staphylococcus schleiferi 1360-13: LH95_11480Help
Entry
LH95_11480        CDS       T04012                                 

Definition
(GenBank) homocysteine methyltransferase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00270  Cysteine and methionine metabolism
ssch00670  One carbon pool by folate
ssch01100  Metabolic pathways
ssch01110  Biosynthesis of secondary metabolites
ssch01120  Microbial metabolism in diverse environments
ssch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LH95_11480
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LH95_11480
Enzymes [BR:ssch01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LH95_11480
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     LH95_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR PK
Motif
Other DBs
NCBI-ProteinID: AKS68031
Position
2413309..2415150
Genome map
AA seq 613 aa AA seqDB search
MSRLLKALQNNVLVADGAMGTILYSEGLDTCPEAYNLTHPEKVEHIHRSYIEAGADVIQT
NTYGANFEKLKPFGLEHKVKAIHQAAVAIAKRAARPDTFILGTVGGFRGVKQGELSLSAI
QYHTEIQVDTLIESGVDGLLFETYYDLTELIRVITQTRQNYDIPIIAQLTASNTNYLRDG
TEINDALQQIVAAGANVVGLNCHHGPHHMKHSFSHIALPKKAYLSCYPNASLLDLDQHTF
KYSDNAQYFGNTAQQLIQEGVRLIGGCCGTTPEHIRHIKSAVKGLKPIQNKKVIPIDKKR
ETLTQNQHQLNLADRVQQKPTIIVELDTPKHLDTTKFFNNVKALDEANIDAVTLADNSLA
TVRISNIAAASLIKQRFDIEPLVHITCRDRNLIGLQSHLLGLSLLGIHEILAITGDPSKI
GHLPGATNVYDVNSKGLTELALKFNKGINTDGDALKTTTQFNIAGGFDPHVRNIKAAVRK
METKIESGMSYFITQPVFSKEKIIEIYEATKHLNVPIFIGVMPVTSYNNALFLHNEVPGI
KMSEEILEQFKAVAGDKEATYQLSISLCKSLIDTVHTYFKGLYLITPFERVDYSLELAAY
SKSITQTHQEAIL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggttgttaaaagcgctacaaaacaacgttctagtggctgatggtgcaatggga
acgattctttactctgaaggcttagatacctgtccagaagcatataacctgacgcatcct
gaaaaggtcgagcatattcatcgctcttacatcgaagctggtgcagatgtcattcaaacg
aatacgtatggtgccaatttcgaaaagttgaaaccttttggactcgaacataaagtaaag
gccattcatcaagcagcagtagccattgcgaaacgggctgctcgtcctgacactttcatt
ttaggtactgtaggtggttttagaggtgtaaagcaaggtgagttatccttgtctgccatt
caataccatacagaaattcaagtcgatacacttatcgaatcaggtgtagacgggctgttg
tttgaaacctattatgatttaactgagttaattagagtcattactcaaacccgtcaaaat
tacgatattccaatcattgcccaactcacagcttccaatacgaattacttaagagatggt
actgaaattaatgacgcgttacagcaaatcgttgctgccggcgcaaatgttgtcggattg
aactgccatcatgggccacaccatatgaaacactcgtttagtcatattgcactaccgaag
aaagcgtatctctcctgttacccgaatgcgagtttactcgatttggatcagcatacgttt
aaatatagtgataacgcccaatattttggtaatacggcgcaacaacttatccaagaaggt
gtccgcttgattggaggctgttgtggtacgacaccagaacatatacggcacatcaaatct
gccgtaaaaggacttaaaccgatacaaaataaaaaggttatccctattgataaaaaaaga
gaaacgttaacccaaaatcagcatcaacttaatttagctgatcgggttcagcaaaaacca
acaattattgttgagctcgatacgcctaaacacctagatacaacgaaattttttaacaat
gtcaaagctttagatgaagcgaatattgatgcggtcactttagcagacaactcccttgcg
acggtgcgtatttcaaatattgcagctgcaagtttgattaagcaacgatttgatattgaa
cccctcgttcatattacatgtcgggatcgtaacctcattggcttacaatctcatctactc
ggattgtctcttttaggtattcatgaaattcttgcgattacgggtgacccttctaaaatt
ggtcatttaccaggtgcgaccaatgtttacgatgtgaactcaaaaggtctgactgaactc
gcactcaaatttaataaaggcatcaatacggatggtgatgcgctgaaaacaacaacacaa
ttcaacatcgctggtggtttcgacccacacgtcagaaacattaaagccgctgtacgcaaa
atggaaacgaaaatcgaaagcggaatgagttactttattacgcaacctgtattttcaaaa
gaaaaaattattgaaatttatgaagcaacaaagcacctcaatgtccctatttttataggt
gtcatgccggttacaagttacaataatgctttatttctacataatgaggtgcctggtatc
aaaatgtcagaagagatactcgagcaatttaaagcagtagcaggtgacaaagaagcaacc
taccaacttagcatttcactttgtaagtcactcattgatacagttcacacatattttaag
ggtctctatttaattacaccttttgaacgtgtggactattcattagaacttgcagcttat
tcaaaatcaattacacaaacccatcaggaggcgatattatga

DBGET integrated database retrieval system