KEGG   Sporothrix schenckii: SPSK_00697Help
Entry
SPSK_00697        CDS       T05555                                 

Definition
(RefSeq) phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00564  Glycerophospholipid metabolism
ssck00565  Ether lipid metabolism
ssck00590  Arachidonic acid metabolism
ssck00591  Linoleic acid metabolism
ssck00592  alpha-Linolenic acid metabolism
ssck01100  Metabolic pathways
ssck01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPSK_00697
   00565 Ether lipid metabolism
    SPSK_00697
   00590 Arachidonic acid metabolism
    SPSK_00697
   00591 Linoleic acid metabolism
    SPSK_00697
   00592 alpha-Linolenic acid metabolism
    SPSK_00697
Enzymes [BR:ssck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SPSK_00697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B DUF3295 Cnd1_N
Motif
Other DBs
NCBI-GeneID: 27662923
NCBI-ProteinID: XP_016584479
UniProt: A0A0F2LWH1
Position
Unknown
AA seq 874 aa AA seqDB search
MSSRQALRHSCSAARVHGGARSPRPRAPMAAHRLPIYARRFASSLGGPSKTSSAVRTTAT
TAASLLAIGSLLVFSLAPRDQHMRLDAAPALERRRTTKETQPSWAQNGKDDDEASLLSAG
SESDMQKDKEVSTISAVGTWFRDVANVDWSAIPDRITGFILPEWSKMVPGFVRKLQRELD
AVPGSLSDEIWREARDPTVHPEVQFGARVRVADDLCRDEKAFRQHRKPVTAAALAKYLDL
PADDVHPDDVPVIALCGSGGGLRALVAGTGSLMAAEKAGLFDCVTYMAGVSGSCWMQTLY
FSSFTHQDFGRVADHLKARLGVHIAHPPELFALLTSAPTNKYLLSGAVERYKADPTTKFG
LVDVYGTLLAARLLVPRGELDVSALDYKISSQRRHLTRGQNPMPIYTAVRHEIPGLEDDD
GIKDGAVGPSASGDDAKKEAWFQWFEITPYEFFCEEFSAGIPTWAMGRTFHRGRDVPLAA
PNGQGDYHLPEVRTPLMLGIFGSAFCATLSHYYKEIRPIVQSISGMSGLDEMIWGRNDDL
SKVHPIEPATLPNPVYGMHPSQLPVTVPPGLFARKHIQLMDAGMSNNLPLYPFLRPGRGV
EVVVVFDASADIRKDNWLCVADGYARRRGIKGWPVGVGWPPADDPPEKTAQQLKDAGASA
EATPDDKIEQAKADQAAHQRQNETGSTTTTTKKDKRMGGAIGKQGSREAENAKAAAKELG
YCTVWVGSTAEKVSTAQEAAETEAAQSGDKEDKKGTKQVEMAPPIDESTQWRLTAPDAGL
TLVYLPYLANEAKVPGVDPATSDFMSTWNFVYQPEEVDKAVALARANFNEGADQIRATVR
AVYERKKQMRLAAEERHKRERLRRLVKQEGNHFN
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacgacaggcgctccggcacagctgctcggccgctcgggtgcacggcggtgca
agatcgcctcggccacgagcaccgatggctgcgcaccgcctcccaatttacgcccgtcgc
tttgcatcgtctctcggcgggccgtcaaagacaagcagcgcagtcagaacgacagccacc
actgccgcctcactgctggccattggcagtctcctcgtcttctctctcgcaccgcgcgac
cagcacatgcgccttgacgctgctccggccctagaacgtcggcgaacgacgaaagagaca
cagccgtcgtgggcgcaaaacgggaaggatgacgacgaggcgagtcttctttcggccggg
agcgagagcgacatgcaaaaggacaaggaggtcagcaccatatctgccgttggcacgtgg
ttccgcgacgtcgccaatgtcgactggagcgccatccccgaccgcatcacgggcttcatc
ctgcccgagtggtccaagatggtccctggctttgtgcgcaagttgcagcgcgaactcgac
gccgtgcctggatccctgtccgacgagatttggcgcgaggcccgtgacccgaccgtccac
cccgaagtccagttcggcgcccgcgtgcgcgtggcggacgacctgtgccgcgacgaaaag
gcctttcgccagcaccgcaagcccgtgacggcggccgccctcgccaagtacctcgacctc
cctgccgacgacgtgcaccccgacgacgtgcccgtgattgcgttgtgcgggtcgggcggc
gggctgcgcgcgctcgtggccggcacgggctcgctgatggcggccgaaaaggccgggctg
tttgactgcgtgacctacatggccggcgtcagcggctcctgctggatgcagacgctgtac
ttttcgtcgtttacgcaccaggactttggccgcgtggccgaccacctcaaggcccgcctg
ggcgtgcacattgcgcacccgccggagctgtttgcgctgctgacgagcgcacccacgaac
aagtacctgctgagcggggccgtcgagcgctacaaggccgacccgacgaccaagtttggg
ctggtcgacgtctacggcacgctgctggctgcgcgcctgctggtgccgcgtggcgagctg
gacgtgagcgcgctcgactacaagatctcgagccagcggcggcacctgacgcggggccag
aacccgatgcccatctacacggccgtgcgccacgagatccctgggctcgaggacgacgac
ggcatcaaggacggcgcggtgggcccgtcggcgtcgggcgacgacgccaagaaagaggcc
tggttccagtggtttgagatcacgccctacgagttcttctgcgaagagttttcggcgggc
atccccacgtgggccatgggccgcacctttcaccgcggccgggacgtgccgctggcggcg
cccaacggccagggcgactaccacctgcccgaggtgcgcacgccgctgatgttgggcatc
tttggcagcgccttctgcgccacgctcagccactactacaaggaaatccgccccatcgtc
cagagcatcagcggcatgtcgggcctcgacgagatgatctggggccgcaacgacgacttg
agcaaggtgcacccgatcgagccggccacgctgcccaacccggtgtatggcatgcacccc
agccagctgcccgtgacggtgccgcccggtctgtttgcgcgcaagcacatccagctcatg
gacgccggcatgtccaacaacctgccgctgtacccgttcctgcggcccggccgcggtgtc
gaggtggtggtcgtctttgacgcgtcggccgacatccgcaaggacaactggctgtgcgtc
gcggacggctatgcccggcgtcgcggcatcaagggctggccggtgggtgtgggctggccg
ccggccgacgacccaccggagaagacggcgcagcagctcaaggacgcgggcgcgagcgcc
gaggcgacgccggacgacaagattgaacaggccaaagccgaccaggccgcgcaccaacgg
caaaacgaaaccggctcaacgacgacgacgacgaagaaggataagaggatgggtggtgcc
attggcaaacagggctcacgtgaagccgagaatgccaaggcggcggccaaggagctcggc
tactgcacggtgtgggttggctcgacggccgagaaggtgtccacggcgcaagaggcggcc
gagaccgaggcggcgcagagtggcgacaaggaggacaagaaaggcacgaaacaggtcgaa
atggcaccgcccattgacgagtcgacgcagtggcggctgacagcgcccgatgcgggcctg
acgctcgtgtacttgccgtacctggccaacgaggccaaggtaccgggcgtcgacccggcg
acgagcgatttcatgagcacgtggaactttgtgtaccagcccgaggaagtggacaaggcg
gtggcgctggcccgggccaatttcaacgagggcgcggaccagatccgggcgaccgtgcgg
gctgtctacgagcgcaagaagcagatgcggctggcggccgaggagcggcacaagagggag
cggctgcggcggctggtcaagcaggagggcaaccattttaattaa

DBGET integrated database retrieval system