KEGG   Sporothrix schenckii: SPSK_01660Help
Entry
SPSK_01660        CDS       T05555                                 

Definition
(RefSeq) polyamine oxidase (propane-1,3-diamine-forming)
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00330  Arginine and proline metabolism
ssck00410  beta-Alanine metabolism
ssck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SPSK_01660
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPSK_01660
Enzymes [BR:ssck01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     SPSK_01660
    1.5.3.16  spermine oxidase
     SPSK_01660
    1.5.3.-  
     SPSK_01660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 Pyr_redox GIDA NAD_binding_9 AlaDh_PNT_C FAD_oxidored Shikimate_DH DAO FAD_binding_2 ThiF HI0933_like Pyr_redox_3 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-GeneID: 27663844
NCBI-ProteinID: XP_016590268
UniProt: A0A0F2MD70
Position
Unknown
AA seq 537 aa AA seqDB search
MPSLLNCVALLAGASCTVALAIEQPRHAASSSTGSCRKTKVAVLGAGVAGITAAQALANA
SVTDFLLVDRNDYIGGRVAHTTFGTKADNSSYTVELGANWVQGLGSPGGPENPIWTLAKR
YGLNNTYSNYSSLLTYDHTGSVDYTDVMDAYDATYEVAAADAGVLLTDNLQDTSARVGFS
LADWKPKKDMHAQAVEFWNWDWETAYAPEDCSFVFGVSGNNLTFNQFSDENNYVWDQRGF
NTFLYGEASTFLAENDPRLLLSTTVTNITYSDSGVTVVFEDGGCVEADHAICTFSLGVLQ
NDVIDFEPPLPRWKVDAIESFEMGTYTKIFLQFNETFWDEDVQYFLYADPQVRGYYPVWQ
SLDGPGFLEGSHILFVTVVGAESYRVEQQDDQVTLAESMAVLRSMFPDIDVPDPLAILYP
RWSLEEWAFGSYSNWPVGMTLEKHQNLRANVGHLWFAGEANSAEYFGFLHGAWFEGREVG
QRVAAALQDKTGGHGHHNASWNMARYEVLHGTTNLNEYNYYNGWPVSSFVDYDTSSN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacttttgaactgtgtggccctcttggccggggccagctgcactgttgccctc
gccatcgagcagccccgacatgccgcatcgtccagcaccggcagctgtcgcaagacgaag
gtcgccgtgctcggtgcaggcgtggccggcatcacggccgctcaggcgctggccaatgca
tcggtcaccgatttcttgctcgtcgaccgcaacgactacatcggcggccgcgttgcacac
acgacgtttggcacaaaggccgacaactcgtcgtacaccgtcgagctcggtgccaactgg
gtccagggtcttggttcgccaggcgggcccgagaaccccatctggaccctggccaagcgc
tacgggctcaacaacacctactccaactacagctccctgctgacctacgaccacaccggg
tctgtcgactacacggacgtcatggacgcgtacgatgcgacgtacgaggtggccgccgcc
gacgcgggcgtattgctcaccgacaacttgcaggacacgagtgcccgcgtcgggttcagc
ctggccgactggaagcccaaaaaggacatgcacgcccaggcggtcgagttctggaactgg
gactgggagacggcgtacgcgcccgaagactgcagcttcgtgtttggcgtgtcgggcaac
aacctgacctttaaccagttcagcgacgagaacaactacgtctgggaccagcgcggtttc
aacacctttctgtatggcgaggccagcacgttcctcgccgaaaacgacccacgcctgctg
ctctccaccacggtcaccaacatcacctactctgattctggcgttacagtcgtcttcgag
gacggcggctgcgttgaggccgaccacgccatctgcaccttctcgctcggtgtcctgcaa
aacgacgtcatcgactttgagccgccgctgccgcgctggaaggtggacgccatcgagtcc
tttgagatgggcacctacacaaaaatcttcttgcagttcaacgagacattttgggacgag
gacgtccagtactttttgtacgccgacccccaggtgcgcggctactacccggtgtggcag
tcgctcgacggccccggtttcttggagggctcgcacattctgtttgtgacggtcgtgggc
gccgagtcataccgtgtcgagcagcaggacgaccaagttacactggccgagagcatggcg
gttctgcgcagcatgttccccgacattgacgtccccgacccgctggccatcctctacccg
cgctggagtctggaagagtgggcgtttggctcgtacagcaactggcccgtcggcatgacc
ctcgagaagcaccagaacctccgcgccaacgtcggccatctctggtttgctggtgaggcc
aactcggccgagtactttggcttcctgcacggcgcctggttcgagggccgcgaagtcggc
cagcgcgtggcggctgcactccaggacaagacgggcggacacggccatcacaatgcgtcg
tggaacatggcccggtacgaggtcctgcatggcaccaccaacctcaacgagtacaactac
tacaacggctggcctgtcagcagttttgtggactacgacacgagctcgaactag

DBGET integrated database retrieval system