KEGG   Sporothrix schenckii: SPSK_02230Help
Entry
SPSK_02230        CDS       T05555                                 

Definition
(RefSeq) translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
ssck  Sporothrix schenckii
Pathway
ssck03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    SPSK_02230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ssck03012]
    SPSK_02230
Translation factors [BR:ssck03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    SPSK_02230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF2457 PSII_Pbs27 CDC45
Motif
Other DBs
NCBI-GeneID: 27664380
NCBI-ProteinID: XP_016589401
UniProt: A0A0F2MCZ3
Position
Unknown
AA seq 870 aa AA seqDB search
MSATRFFRSGNDSSSESSSDEEELYSDEEEELDELDDDDEDEDDDDDDDDDDDDDDSDTD
SDGDRPRGANAFLLDADSGASSDEEEPSAKVKSAKDKRFDELDATITAIENGEKINDWGS
ISTEFDKLNRQAEKLRQGSKAPKLYIKAVADLEDFLNESISMQKVSLKKMNATSARGLNA
VKQRIRKVVKEYQSQIDEYRADKDEFMESDEEEAPAPRRAPAAVTFAPTEEEGDDQGFST
VIGKGGRVVQFTPDGIFKQLRTIMESRGKKNTDRPEQIKIMEKLNEIAVTPYQQIRVLLT
LVSARFDLGSGAATFMPLEHWKAAEKELGQLFKILEKNKEYIVIENAEEWDDDDKPPTLE
AGQKYIKIPGSIVSYVERLDDELVRSLQNIDPHTSEYIDRLQDEGALYNTIVLGQLYYET
LRKDSSLEIPQESLNRIVMRRLEHIYFKPAQVVKILDENSWKEATSGIDSTITPRAESSE
PSGLLNLLCGYLFANSEGIIRARAMLCQIYFLALHDDYYRARDMMLMSHLQETINSFDVQ
SQILYNRTLVQVGLCAFRKGLVYDAQNTLQEICGSGRQKELLAQGVMIQRYSQVSPEQER
IEKQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDIKKRVISKTYRRMLEYHE
RQIFTGPPENTRDHVMQASKTLAAGEWKKAIEFIHSIKIWELMPQADSIKAMLAKQIQEE
GVRTFLFTYAPFYDTLALETLSNMFELETHKISAIISKMISHEELAAALDQVNQTVIFRK
GVELSRLQSLALTLSDKASALTESNERTLEQRTQGSANAFDRQGGRGRGGGRGGGGARGG
RGGARAGGNTQRQAGGTQFTGGALGAAVRA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacgcgctttttccgctccggaaacgacagctccagcgagagcagctccgac
gaggaggaactctactccgatgaggaggaggagctcgacgagctcgacgacgatgacgag
gacgaggacgacgatgatgacgatgacgacgacgacgacgatgatgactcggataccgac
tcggacggcgacaggccgcggggagcgaacgcgttcttgctcgacgcagattcaggcgcc
agctccgacgaggaggagccctctgccaaggtgaagagcgcgaaagacaagcggttcgac
gagctcgatgccacaatcacggcgattgagaacggcgagaagatcaacgactggggctcg
atctcaactgagttcgataagctgaatcgccaggccgagaagctgcgccagggttccaag
gcccccaagctctacatcaaggccgttgccgacctcgaggactttttgaacgagtcgatc
tccatgcagaaggtctccctgaagaagatgaacgcgaccagcgcacgtggcctgaacgcc
gtcaagcagcgcatacgcaaggtcgtcaaggagtaccagagccagatcgacgagtaccgt
gccgacaaggatgagttcatggagtctgacgaggaggaggccccggcgccaagaagggcg
cccgctgccgttacgtttgcccccaccgaagaggagggtgacgaccagggcttctcgacg
gttattggcaagggtggccgtgttgttcagttcacgcccgatggcatcttcaagcagctg
cggacaatcatggagtcccgcggtaagaagaacaccgaccggccagagcagatcaagatt
atggagaagctcaacgagattgccgtgacgccgtaccagcagatccgcgtcctgctgacg
ctcgtctcggcacgcttcgacctgggctcgggcgctgccaccttcatgccactcgaacac
tggaaggccgccgagaaggagctgggccagctcttcaagatcctcgagaagaacaaggag
tacattgtcatcgagaacgccgaggagtgggacgacgacgacaagccgcccaccctggag
gccggccagaagtacatcaagatcccaggcagcatcgtctcgtacgttgagcgtctggac
gacgagttggtccgctctctccagaacattgacccccacacgtccgagtacatcgaccgc
ctccaggacgagggtgccctgtacaacaccattgtcctgggccaactttactacgagacg
ctccgcaaggactcgtccctggagatcccccaagagagcctgaaccgcattgtcatgcgg
agactcgagcacatctacttcaagccggcgcaggtggtcaagatcctggatgagaacagc
tggaaggaggccaccagcggcatcgactcgacgattacgccgcgcgccgagtcgagcgag
ccttccggtctgctgaacctgctgtgcggctacctgtttgccaacagcgaggggatcatc
cgcgcccgtgccatgctgtgccagatctacttcctggcgctgcacgacgactactaccgc
gcgcgtgacatgatgctcatgtcgcatctgcaggagacgatcaacagcttcgatgtgcag
tcgcagatcctgtacaaccggacgctggtgcaggtcggcctctgcgcattccgcaagggt
cttgtgtacgatgcgcagaacacgctgcaggagatctgcggcagtggccggcagaaggag
ctcctggcgcagggcgtcatgatccagcgctacagccaggtctcgcccgagcaggagcgc
attgagaagcagcgccagctgccgttccacatgcacatcaacctcgagctgctcgagtgc
gtgtacctgacgtgcagcatgctgctggagatcccgctgctggcgcagaccggctcgtcg
ccggacatcaagaagcgggtgattagcaagacgtaccgccgcatgctcgagtaccacgag
cgccagatcttcacgggcccgccggagaacacacgcgaccacgtgatgcaggcctcgaag
acgctggcggcgggcgagtggaagaaggcgattgagttcatccacagcatcaagatctgg
gagctgatgccgcaggccgacagcatcaaggccatgctggccaagcagatccaggaggag
ggtgtgcgcacgttcctgttcacgtacgcgcccttctacgacacgctggccctggagacg
ctcagcaacatgtttgagctggagacgcacaagatctcggccatcatcagcaagatgatc
agccacgaggagctggcggcggccttggaccaggtcaaccagacggtcatcttccgcaag
ggcgtcgagctgtcgcgcctgcagagcctggctctgacgctgtccgacaaggccagcgcg
ctgacggagtcaaacgagcggacactggagcagcggacacagggctcggccaacgccttc
gacagacaaggcggccgcggccggggcggtggccgtggtggtggtggcgcacgaggcggc
cgcggaggcgctcgtgccggcggcaacacgcaacggcaggcgggcggcacgcagttcaca
ggcggcgcactgggtgctgccgtccgggcttga

DBGET integrated database retrieval system