KEGG   Sporothrix schenckii: SPSK_02946
Entry
SPSK_02946        CDS       T05555                                 

Definition
(RefSeq) nitrite reductase (NAD(P)H) large subunit
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00910  Nitrogen metabolism
ssck01100  Metabolic pathways
Module
ssck_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ssck_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SPSK_02946
Enzymes [BR:ssck01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     SPSK_02946
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske NIR_SIR_ferr Rieske_2 Pyr_redox_3 Rubredoxin_C Collagen
Other DBs
NCBI-GeneID: 27665069
NCBI-ProteinID: XP_016584557
UniProt: A0A0F2M145
Position
Unknown
AA seq 1116 aa
MADSAPHTNGDNGINGDNGINGVNGINGVNGINGVNGNNGLQSSHPPRTRIVVVGLGMVA
MSFMEKLMQLDAKRREYSLVVIGEEPHLAYNRVGLSTFFEHRVVENLYLNPREWYSSLED
DGSLNYHVNTRVAEIRPAAKNVVTSMGVVIAYDILVLATGSEAVLPATTAGHDSHGVFVY
RTIADLENMMQFADEHKGSVGVAVGGGLLGLEAAKAMVDLESFASVKVVDRNNYLLARQL
DADAGRLVTEGVRKLGLDVLHNKRIATINTDVDKSVTGITFEDGEQLNCSAVCFAIGVQP
RDELASSAGIRTGERNGGFVVGEDLQTSVPDIFAIGDCACWQNQTFGIIAPGIEMADVLS
FNLTEGRLGSGQPPRKFDRPDLSTKLKLLGIDVASFGDFFADRDGPKSVPNGGLSPESAP
VKALTYKDPFGSVYKKYLFTPDGKYLLGGMMIGDTRDYAKLTQIVRTQAVLEAPPSQFIL
GAQKIGEDDGSDLTDDTQVCSCHNVTKGDVVEAVKSGKCTDLNGLKACTKAGTGCGGCIP
LVQSILNRTLKDLGQDVSNHLCPHFSRPRADLYNIIAVKRLTTFEAVMRDAGTFPESLGC
EICKPTIGSILASLFNEPVVSRQHHDLQDTNDRFMANIQRNGTFSVVPRVPGGEITPKQL
IAMGQVADKYGLYCKITGGQRIDMFGARKQDLLAIWREMVDAGLESGHAYAKALRTVKSC
VGSTWCRFGVGDSVGMAIRAEERYKSIRAPHKIKGGVSGCVRECAEAQSKDFGLIATEKG
YNIFVGGNGGAKPRHAELLAKDVPPEEVIPILDRYLIFYIRTADRLQRTARWLESLPGGI
TYLKEVVLEDKLGICAEMEKQMQELVDSYFCEWTEILADPVRQSVFRQFDNTDEDVETVE
VVVEREQTRPTYWSQESASEDFRSHHWSQLAWEPLLETKHFDADGRSSAHIKRGDTQLAV
FRVRGRYYATQQMCPHKRAFVLSDGLVGEQAAKANKKCASNGDSSGGSKYWVSCPYHKRN
FDLNGDVPGRCSSDDSLSIATFAAEERDDGWVYLNLPPVEELDAILGTSRWKTRKEEAGD
PFQRLDQKLGKSQKGRKGRKPADIQPPSLQTVSIGW
NT seq 3351 nt   +upstreamnt  +downstreamnt
atggccgacagcgcccctcataccaatggtgacaacggcatcaatggtgacaacggcatc
aatggtgtcaacggcatcaatggtgtcaacggcatcaatggtgttaatgggaataatggc
cttcaaagttcccaccctccccggacccgcatcgtcgttgttggactgggcatggtggct
atgtctttcatggagaaactaatgcagctggacgcgaagcggagggagtacagtctcgtt
gttatcggcgaggaaccgcatctggcatacaaccgcgttggcctgtccactttcttcgag
caccgtgtcgtagagaacctgtacctaaacccgcgagaatggtactcatctctggaggac
gatggatcgctgaattaccacgtcaatacgcgcgtggccgagatccgtcctgcagcaaag
aatgtcgtgacgtccatgggtgtcgtcatcgcatacgacattttggttttagctacgggt
tccgaagccgttttgccagctacaacggccggccacgatagccatggcgtcttcgtatac
aggacaatcgccgaccttgagaatatgatgcagttcgcagatgagcacaaaggctccgtc
ggcgttgcagtcggcggtggtttgcttgggctcgaggctgcgaaggcaatggtagacctc
gagtctttcgcatcggtcaaagttgtcgaccgcaacaactacctgctcgctcggcagctg
gacgccgatgccggccggctagtcaccgagggggtccgtaaactcggactagacgtttta
cacaacaaacggatcgccaccataaacacggatgtcgacaaaagcgtgaccggaattacg
ttcgaggacggcgagcagctaaattgcagcgctgtctgtttcgcgattggtgtgcagcca
cgagacgaactggcgagctcggctgggatccggacaggagagcgcaatggcggttttgtt
gtcggcgaagatcttcaaacgtccgttcctgacatatttgcgatcggcgactgcgcatgc
tggcagaaccaaacatttggcatcattgccccgggcatcgaaatggccgatgtactttcc
ttcaaccttaccgaaggtcgccttgggtccggccaaccgccacgcaaattcgaccgccct
gatctcagcacgaagctcaagctccttggtattgacgtcgcaagctttggagactttttt
gcagacagagacggaccaaaatcggtcccgaacgggggattaagtcccgaatcagcgccc
gtcaaggctctcacctacaaagatcctttcggatccgtatacaagaaatacctctttaca
ccggacggaaagtatttgctgggtggtatgatgattggtgacacgcgcgactatgccaag
ctcacccaaatcgtgcgtacgcaggcagttctagaggcgccgccaagccagttcatctta
ggtgcccaaaaaattggtgaagatgacggctctgatcttaccgacgatacacaggtctgc
tcgtgtcacaacgtgacgaagggtgacgttgtcgaagctgtcaagtcaggaaagtgcaca
gatctgaacggactgaaggcttgcacgaaggcgggtactggctgtggtggatgtattcca
cttgtgcagagcattctcaaccggacactgaaagatcttggacaagatgtttccaaccac
ctctgccctcacttttcccggccgcgtgccgacctctacaacatcatcgctgtcaagcgc
ctcacaacatttgaagctgttatgcgcgatgcaggcacattcccagagtcacttggctgc
gagatatgcaagccaactatcggatccattctagctagtctgttcaatgagccagtggtg
tcacgacaacaccatgacctccaggacacaaacgaccgcttcatggccaacatccaacgc
aacggaacattttcggttgtcccgcgcgtgcccggtggcgagatcacaccgaagcagctg
atcgccatgggccaagttgccgacaagtacgggctctactgcaagatcactggaggccag
cggattgacatgttcggagcacggaaacaggacttgcttgccatttggagggaaatggtg
gatgcagggctcgaaagcggccatgcatatgcaaaggctttgcggacagtcaagagttgt
gtgggatcgacttggtgccgcttcggtgtaggcgacagcgttggcatggctattcgtgct
gaggagcggtacaaaagcattcgggcccctcacaagatcaaggggggtgtatccggttgc
gtacgcgaatgtgcagaggcacagagcaaagacttcggtctcattgcaacggaaaagggc
tacaatatatttgttggcggcaacggcggcgcgaaaccccggcacgcagaacttctggcc
aaagatgtgccaccagaggaggttattccgatcctagaccgctacctcatcttctacatt
cggacagccgaccgactgcagcggacagctcggtggcttgaaagtctgccgggaggtatc
acctacctgaaagaggtcgttcttgaagacaagctggggatctgtgccgaaatggagaag
cagatgcaggagcttgtcgacagctatttctgcgagtggaccgagattcttgcggatcca
gtcagacagagcgtgttccgccaattcgacaacacggatgaagatgtagagacggtcgag
gtcgtcgttgagcgagagcaaaccagaccaacctactggtctcaggagtcagcgtctgag
gattttcgcagtcatcactggtcgcagcttgcctgggagccgctcctcgaaacgaagcac
tttgatgcagacggacgctcgtcggcgcatatcaagcggggagacacgcagcttgcggtt
ttccgtgttcgtggccggtactatgcgacgcagcagatgtgcccgcacaaacgggcattt
gtgctgtcagacggcttagtcggtgagcaggcggccaaagccaataaaaaatgtgccagt
aacggcgacagtagcggcggaagtaagtactgggtatcgtgcccataccacaagcgcaac
tttgacctcaacggggatgtgcctggacggtgctcaagcgacgattcactgagcatcgca
acttttgcagccgaagagcgtgatgatggatgggtgtacctcaatctccctcccgtggaa
gagctggatgcaatactcggtacttcgaggtggaaaacacggaaggaagaagctggtgac
ccgtttcagaggctggatcagaagttggggaagtcccaaaagggtcgcaaaggccggaag
ccagcagatatacagcctccatctctacagaccgtttcaattggctggtaa

DBGET integrated database retrieval system