KEGG   Sporothrix schenckii: SPSK_03877Help
Entry
SPSK_03877        CDS       T05555                                 

Definition
(RefSeq) vacuolar assembly protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ssck  Sporothrix schenckii
Pathway
ssck04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPSK_03877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssck04131]
    SPSK_03877
Membrane trafficking [BR:ssck04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    SPSK_03877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin zf-RING_11 Vps39_1 zf-RING_5 WD40_like zf-RING_2
Motif
Other DBs
NCBI-GeneID: 27665969
NCBI-ProteinID: XP_016586253
UniProt: A0A0F2M1I7
Position
Unknown
AA seq 1341 aa AA seqDB search
MPAAHTERDDNARGGALKDRRSGDDDTTSEGGSLAGSGSDATGDEARTSRNDKGKGAAAE
EDEEEDADAEEDDENDEDEDEDDEEDSDDEDEEPRLKYARLTTNLGGLYRNGDATSAFLV
AGDKMIVGTHNGNIHVFQLPTFQPLRVYHAHSASVIAISISPFTPPLPSLKIEQINRIVA
EGGAGAGASRPGSSHASPSPNASPRKAREPPPILNIPSNNIHIATASTDGNVCIQSLIDV
KDVQLRNFGRPVQAVALSPEYRQDRTYLSGGLAGNLILTVCGQSGRSTSTTVGTAAATAS
GWLGSMGLSNNAGRDTVLHSGEGTVNNIQWSVSGRYVAWLNEHGIKIMRTRLHLDSADAE
GAWKRIGHVDRPQTEEWDTMASVWKGRAHWIDETMIDADDDVAGQEIGASAEPGISSPAA
EVLRQQQARDSKVIERLLVGWGSTIWMVHVHAGRVKTGKHAGERSVGHAEIVKILRMDCI
ISGISLYTQNLLLVLAYTPADPEEDEDEEGGQAAGKSKSTYTRGHKANKSTASSSSEPTG
GIRRRQNNNPPELRLIDLTSQTEVDKDVLSVSRYERLSAGDYHLSVLPAQTAAAAAVSSK
GALEAIAGLGADMWNAALNPSRMLFSSGQSVKSKDSNEGTTTGSSKAASLASTLRAQSRL
GGFGGQNVHPSLATTGIKIFMHSPYDCILATRRDLSDHLAWLLEHQEFQQAWELINENPD
AVPSYADRPSDAGTMTPDQSTQPMQASDDFYPDAVLDALSREANAPAEREKRRIGELWIK
EIVDTGDWERAGQVAGRVLRSSDRWEKWVWTFAGADQFDAITNYIPTEPLHPPIPRTIYE
IVLGHYLKQDKPRFRELLERWPTELFDINTIVTALENQLNYRDVREDSVEDGERGRDWRI
VMESLARLHDANGRYREALKAYIRLQDADSAFRLIRDNHLADAVIDDIPSFIALRVPAGR
ADKMTRAELEEATAEAMALLVDEAQHGLVQPASVVAQLQAQDLNLYIFLYFRGLWQGEGL
REHQRESHDRLALESKAQLDGFADLAVQLFAQFGDRALLMEFLKASTSYSFEKAAAACER
HNYIDELVYLYSKTGQMKRALYLIIDRLGDVSQAIAFAKEQDDPDLWEDLLNYSMDKPRF
IRGLLEEVGTAIDPITLVRRIPEGLAVEGLRDGLQHIMKEHEIQHSISSGVARVLRSEVA
TAQATLRNGQRKGIRFEVVAPSKVAPAVSSAVPPVATASIDAADGDEKEQPAWTPGHCAR
CLEAFTEWDRDTLVGFACGHVFHLTHLLGKSTDEVEELGFGVDDELISRHNITATKIMHA
RLLRDHVRDGCPVCVKPTAVA
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagcgcacacagagcgagacgacaacgcaagaggcggtgcattgaaggatcgg
aggagtggtgacgacgacacgacgtctgagggtggcagcttggccggcagcggcagcgac
gcgactggcgacgaagcgaggaccagccgaaacgataagggcaagggggcggccgctgag
gaggatgaggaggaggatgccgacgctgaagaggatgacgagaatgatgaggatgaagat
gaggacgatgaagaggacagcgatgacgaggacgaagagccgcggctcaagtatgcccgt
ctgacgaccaacctcggcggcctatatcgcaacggcgatgcgacaagcgcgtttctcgtc
gccggcgacaagatgatcgtcggaacacacaatggcaatattcacgtcttccaactgccg
acctttcagcctttgcgcgtctaccatgcccactcggcatccgtcatcgccatctccatc
tcgccctttacgccgccgcttccgagcctcaagattgagcagatcaaccgcatcgtggct
gagggtggcgccggtgccggtgcttcacggcctggctcgtcgcacgcgtcgccttcgccc
aacgcatcgccacgcaaggcgcgcgagccgccaccgatcctcaacatcccttccaacaac
atccacattgctaccgcgtcgacggacggcaacgtttgcatccagtcactcatcgacgtc
aaggatgtgcagctgcgcaacttcgggcgccccgtgcaggccgtggccctctcccccgag
taccggcaggaccggacgtatctctcgggtggtcttgcgggcaacctgatcttgacggtc
tgcgggcagtccgggcgcagcacatcgacgacggtgggcacggcggcggcgacggcgtcg
ggctggctcggcagcatgggcctcagcaacaacgcgggccgcgacacggtgctgcactcg
ggcgagggaacagtcaacaacatccagtggtcggtgtctgggcgatacgtggcgtggctg
aacgagcacggcatcaagattatgcgtacgcgactgcatctagacagtgccgatgccgag
ggtgcgtggaagcgcattgggcacgtggaccggccacagacggaggagtgggacacgatg
gcaagcgtgtggaagggccgcgcgcactggattgatgagacaatgatcgatgccgacgac
gacgtggccggacaagagatcggcgcgtccgccgagccgggcatctcgtcgcccgcagct
gaggtgctgaggcagcagcaagcccgcgatagtaaggttattgagcggcttcttgtcggc
tggggcagcacaatctggatggtgcatgtccacgcaggtcgagtcaaaaccggcaagcac
gccggcgagcgatccgtcggccacgccgagatcgtcaagatcctccgaatggactgcatt
atatccggtatctctctttacacgcaaaacttattacttgtacttgcctacacgcctgcc
gatcccgaggaggacgaggacgaagaagggggccaggcggcaggtaaatctaagtcaacg
tacacacgcgggcacaaggcgaacaaatcgacagcgtcgagcagcagcgagcccacgggc
ggcatccggcgacgacagaataacaacccgccagaactgcggctcatcgacttgacctcg
cagacggaggtggacaaggacgtgctgagtgtgagccgatacgagcggttgtcggcgggc
gactaccacttgagcgtattgcccgcacagacggcggcagcagcagcagtttcgtccaag
ggcgcgctcgaggcgattgccggactcggcgcggatatgtggaacgctgcactcaaccct
agtaggatgctcttcagctcgggccagagcgtcaagagcaaggatagcaacgaaggcacg
acgacggggagctccaaggcggctagcttggctagcacattgcgggcgcagtcccgcctg
ggcggcttcggcgggcagaatgtgcatccgtcgctggcgacaaccggtatcaagatcttt
atgcacagtccgtacgactgcattctcgcgacgagacgtgacctgtccgaccaccttgct
tggcttctggagcaccaggagttccagcaggcgtgggaactgatcaacgagaacccggat
gcggtgccttcgtatgccgaccgaccgtctgacgccggcacaatgacgcccgaccagtcg
acgcagccgatgcaggcttcggacgacttttaccccgacgcggtgctcgatgccctcagc
cgagaggccaatgcgccggcggagcgcgagaagcggcgtatcggcgagctgtggatcaag
gagattgtcgacacgggcgactgggagcgggcggggcaggtcgcgggcagagtgctgcgc
agctcggaccggtgggagaagtgggtgtggacgtttgcgggcgcagaccagttcgacgcc
atcaccaactacattccgacggagccgctgcacccgccgatcccgcggaccatctacgag
attgtgctgggccactacttgaaacaagacaagccgcggttccgcgagctgctggagcgg
tggccgacggagctgtttgacatcaacacgattgtgacggcgctcgagaaccagctcaac
taccgcgacgtgcgcgaggacagcgtcgaggacggcgagcgcgggcgcgactggcgcatc
gtgatggagtcactggcccggctgcacgatgccaacgggcggtaccgcgaggcgctgaag
gcgtacatccggctgcaggacgccgactcggcgttccgactgatccgcgacaaccacctg
gccgacgcggtgattgacgacatccccagcttcattgcgctgcgcgtgcccgccggccgc
gccgacaagatgacgcgcgccgagctcgaagaggcgacggccgaggcgatggcgctgctc
gtggacgaggcacagcacgggctggtgcagccggcgtcggtggtggcgcagctgcaggcg
caggacctgaacctgtacatttttctgtacttccgcgggctgtggcagggcgagggtctg
cgggagcaccagcgcgagtcgcacgaccggctggcgctcgagagcaaggcgcagctggac
gggtttgcggacctggccgtgcagctgtttgcgcagtttggggaccgcgcgctgctgatg
gagttcttgaaggcgtcgacgtcgtattcgtttgagaaggcggcggcggcgtgcgagcgc
cacaactacatcgacgagctggtgtacctgtactccaagacgggccagatgaagcgcgcg
ctgtacctcatcatcgaccggctcggcgacgtcagccaggcgatagcgtttgccaaagag
caggacgacccagacctgtgggaggacctgctcaactacagcatggacaagccgcggttc
atccggggcctgctggaagaggtgggcacggccatcgacccgatcacgctggtgcggcgg
atccccgagggcctggcggtggaggggctgcgggacgggctgcagcacattatgaaagag
cacgagatccagcacagcatcagttcgggcgtggcgcgggtgctgcgcagcgaggtggcg
acggcccaggccacgttgcggaatggacagcgcaagggcatccggttcgaggtggtggcg
cccagcaaggtcgccccggccgtgtcttcggccgtgcccccggtggcgacggcttccatc
gatgctgccgacggcgacgaaaaagagcagccggcctggacgcctggccactgtgcgcgc
tgcctcgaagcctttaccgagtgggacagggacacgctggtgggctttgcgtgtggccac
gtgttccacctgacgcatctgttgggcaagtcgacggacgaggtcgaggagctcgggttc
ggcgtggacgacgagctgatcagccggcacaacattacggcgaccaagatcatgcatgcc
cggttgctcagggaccacgtccgagacggttgtccagtctgtgtcaagccgacggcggtg
gcctga

DBGET integrated database retrieval system