KEGG   Sporothrix schenckii: SPSK_04076Help
Entry
SPSK_04076        CDS       T05555                                 

Definition
(RefSeq) aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00970  Aminoacyl-tRNA biosynthesis
ssck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPSK_04076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssck03029]
    SPSK_04076
Enzymes [BR:ssck01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPSK_04076
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPSK_04076
Mitochondrial biogenesis [BR:ssck03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPSK_04076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 27666164
NCBI-ProteinID: XP_016586235
UniProt: A0A0F2M376
Position
Unknown
AA seq 679 aa AA seqDB search
MAGLPARPLGRCLFRGRSARRTLLWAGGCPQCRPLLAFRHDRFSSTSTTSPTTTTPPTRA
LPVSLRKQIKDETKARKAKAAQQKGSAAGSGLAHRGQTVPGWELTVGIEIHAQLNTAHKL
FSSAQATSPLSESEPNAPAHVAFFDVALPGAQPIFQPATLIPAIRAALALGCTIQPVSRF
DRKHYFHWDQPAGYQLTQYYEPLARDGHVDLYGDRDGIAAEDGDHVRVAIVQVQMEQDTA
KTVAQPGGVHWLDYNRVGMPLVEIITAPQLHHPATAAAFVRKVQQLLVAVDACTSGLEAG
GLRADVNVSVRRVAGGDSERGEDKADTERLGVRTEIKNLNSFRAVEDAIIAERNRQIAAI
MAAEAAGHVSPRDAIVSETRGWTPPAFAGDEGKTHRLRGKEGEVDYRYMPDPDLGPVVID
EALVRFLQLTLGASPDAEMDDLIDNFGLSPTDVAALMALDGGGRAQYYYDVVEAVEQRLA
AATGAAPGVEVRAFVANWVLHQLGRLTSDRHASVNIGDDAAASTTATATTTTSLDMTPEG
RCRIPVACLADILAYRYQGRITAGVAKELLFAVFRGDVTDTDGGPSVTDAIAAERLWFDE
ISADEYAALAQEAIADEAKTLKQFASPAAQKKYPHGKLQYLVGKLLRLGPEGRTDPQNAE
AAVRAAVARWVEDSQRHTA
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggctggactgccggcacgaccactagggcggtgcctctttcggggtcggagtgcccgg
cgcacacttctctgggccggtggctgcccacaatgtcgtccattgcttgcctttcgacac
gatcgattctcgtcgacgtcgacgacctcgccaaccacaacaacgccgccgacaagagcc
ctccctgtctcactccgaaaacagatcaaagacgaaaccaaggcgcgcaaggccaaggct
gcgcagcaaaagggatctgccgccggcagcgggttggcccaccgcggccagacggtgccc
ggctgggagctgacggtgggcatcgagatccacgcgcagctgaacacggcgcacaagctg
ttttcgagcgcgcaggccacgagcccgctgtcggagagcgagccgaacgcgccggcgcac
gtggccttctttgacgtggcgctgccgggcgcccagcccatcttccagccggcgacgctg
atcccggcgatccgcgcggcgctcgcgctcgggtgcaccatccagccggtcagccggttc
gaccgcaagcactacttccactgggaccagccggccgggtaccagctgacgcagtactac
gagccgctggcgcgcgacgggcacgtcgacctgtacggggaccgcgacgggatcgcggcc
gaggacggcgaccacgtgcgggtggcgattgtgcaggtgcagatggagcaggacacggcc
aagacggtggcgcagcccggcggcgtgcactggctcgactacaaccgggtgggcatgccg
ctggtggagattatcacggcgccgcagctgcaccacccggcgacggcagcggcgtttgtg
cgcaaggtgcagcagctgctggtggcggtggatgcgtgcacgtcggggctggaggcgggc
gggctgcgggcggatgtgaatgtgtcggtccgaagggtcgccggcggcgacagcgagcgc
ggcgaggacaaggcagacacagaacgtctcggggtccgcaccgagatcaagaacctcaac
agcttccgcgcggtcgaggacgccatcattgccgagcgcaaccgccaaatcgcagccatc
atggcggccgaagccgcgggccacgtgtccccccgcgacgccattgtcagcgaaacacgc
ggctggaccccgccggcgtttgccggcgacgagggcaagacgcaccggctgcgcggcaaa
gagggcgaggtggactaccgctacatgccggaccccgacttgggccccgtggtgattgac
gaggccctggtccggtttctgcagctgacgctgggcgcgtcaccggacgcagaaatggac
gacttgatcgacaactttgggctgtcaccgacggacgtggcggcgctgatggcgctggac
ggtggcgggcgggcgcagtactattacgacgtggtggaggcggtggagcagcggctggcg
gcggcgacaggggccgcccctggggtggaggtccgcgcgtttgtggccaactgggtgctg
caccagctggggcggctgacgtcggaccgccacgccagcgtcaacatcggcgacgacgct
gccgccagcaccaccgccaccgcaaccaccaccacctcgctcgacatgacccccgaaggc
cgctgccgcatccccgtggcgtgtctggccgacatcctggcctaccgctaccagggccgc
atcacggccggcgtggccaaggagctgctttttgccgtgttccggggggacgtcacagac
acggacggagggccgtcggtgaccgacgccattgcggccgagcgtctctggttcgacgag
atctccgcagacgagtacgccgcgctcgcgcaagaggccattgccgacgaggcaaagacg
ctcaagcagtttgcatccccggcggcccagaagaagtacccgcacggcaagctgcagtat
ctggtgggcaagctgctgcggctggggcccgaaggccggaccgacccgcagaacgccgaa
gcagcagtgcgggcggcggtggccaggtgggtggaggacagccaacgccacacggcatga

DBGET integrated database retrieval system