KEGG   Sporothrix schenckii: SPSK_04283Help
Entry
SPSK_04283        CDS       T05555                                 

Definition
(RefSeq) beta-glucosidase
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00460  Cyanoamino acid metabolism
ssck00500  Starch and sucrose metabolism
ssck01100  Metabolic pathways
ssck01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPSK_04283
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SPSK_04283
Enzymes [BR:ssck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SPSK_04283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 27666371
NCBI-ProteinID: XP_016586313
UniProt: A0A0F2M1Q0
Position
Unknown
AA seq 465 aa AA seqDB search
MAQEASMFSADDVVTSYSNGTVYHEPVERTVEERQLPPDFAWGVATAAYQVEGAASQDGK
GKSIWDTFTHLEPSRTNGENADITCDHYNRMPEDVALMSSLGVEVYRFSISWSRIIPLGG
RDDPVNENGIAFYNSLIDHLLARNITPVVTLYHWDAPQAIYDRYKAFLDTQQYRVDFLRY
AHVCFTHFGDRVKTWITYNEPYICSIFAHLNGTLAPGHCRATNNATRTEPWRVGHTIILS
HADVANLYTSEFQPAQRGSVSVVLNGHFYEPFDATTAADCAAAENRMIFYIGWFGDPLFL
GEDYPARMRAYLKDRLPEFTQEDRDLLRRTAPLNRFYGMNHYSTKYARALTDPPEDDDWT
GNVEETSMNSEGQEIGPKSGLAWLRVAPEGFRKLLNWVWKRYGRPIIVTENGCPCPGEED
AGVAVDDRFRQRYFGLYLDAISKAIYDDGVRVEGYYAWSFMDNFG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggaagcgtccatgttctcggcagatgatgtcgtgaccagttacagcaatggc
acggtatatcacgagcctgttgaaagaaccgtcgaagaaaggcaactgcccccagacttt
gcctggggcgtggccacagcggcataccaggtcgagggtgctgcttcccaggacggcaaa
ggcaagtcgatatgggacacattcactcacctagagccatctcggacgaacggcgaaaac
gccgacatcacttgtgaccattacaaccgcatgccggaggatgttgctctcatgtcctct
ctgggcgtcgaagtttaccgcttctccatctcgtggtcccgcatcattccgctcggcgga
cgcgacgaccctgtcaatgagaacggcattgccttttacaatagtctaatcgatcacctg
ctcgcccgcaacatcacgcccgtcgtcacgctctaccactgggatgcgcctcaggcgatt
tatgaccgttacaaggcattcctagatacccaacagtaccgtgtggatttccttcgttac
gcccatgtttgcttcactcactttggagatcgcgtcaagacgtggatcacctacaacgag
ccgtacatttgttccatcttcgctcacctcaacggaacgctcgctccggggcactgtcgc
gccacgaataatgccacacgcaccgaaccctggcgagtcggccacaccatcatcctgtcg
catgccgacgtcgccaacctgtacacttctgaattccaacctgcgcaacggggatctgtt
tccgtcgtgctgaatggccacttctacgaaccttttgatgcgaccaccgctgccgactgt
gctgctgccgagaacaggatgattttctacattggctggtttggcgatcctttgttcctc
ggcgaggactacccagctcggatgcgggcctacctgaaggaccgtctgccagagtttaca
caggaagaccgcgacctactccgccgaacggccccgctgaacaggttctacggaatgaac
cactactcgacaaagtatgcgcgggcattgacagaccctcccgaggacgacgactggaca
ggcaacgtggaggagacgagcatgaacagcgaaggccaagagattgggccgaagtcggga
ctggcatggctgcgggtagcgccagaggggttcaggaagttgctgaattgggtgtggaag
cggtacggacggcccattattgtcacggaaaatgggtgtccctgtcctggggaggaagac
gctggcgttgcggttgatgatcgattccggcaaaggtacttcggactgtacctcgatgcc
atttccaaggcgatctacgacgatggcgtgcgagtcgagggctactacgcgtggagcttt
atggacaactttggttag

DBGET integrated database retrieval system