KEGG   Sporothrix schenckii: SPSK_06045Help
Entry
SPSK_06045        CDS       T05555                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00450  Selenocompound metabolism
ssck00970  Aminoacyl-tRNA biosynthesis
ssck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPSK_06045
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPSK_06045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssck01007]
    SPSK_06045
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssck03016]
    SPSK_06045
Enzymes [BR:ssck01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SPSK_06045
Amino acid related enzymes [BR:ssck01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPSK_06045
Transfer RNA biogenesis [BR:ssck03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPSK_06045
 Prokaryotic type
   Other AARSs
    SPSK_06045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 27668030
NCBI-ProteinID: XP_016591767
UniProt: A0A0F2MLM8
Position
Unknown
AA seq 638 aa AA seqDB search
MADSDNVIRPIEGKKNVLITSALPYVNNVPHLGNIIGSTLSADCFSRYSKQRGNPTLYIC
GTDEYGTATETKALEEGVTPRELCDKFHKLHKQIYDDFQINFDYFGRTSTDNHTKIVQEM
FLRLWENKFLDERVTTQPYCETHGAFLADRFVEGTCPRCGYDDARGDQCDQCGNLLDPFE
LINPRCKVCKVNQPPVPRDTKHVFLALDRLQPQMDEWFAKASKEGKWSPNAIAITKSWLD
KGLEGRSITRDLKWGVPVPLPGYEGKVIYVWFDACIGYPSITSCYSEKYWEEWWKTGDVK
LYQFMGKDNTPFHAVTFPSSQLGTGDKWNMVYNISTTEYLNYENTKFSKSRSVGVFGDQA
KDTGIPTSVFRYYLLSSRPESSDTQFEWSSFVQANNSILLANIGNFVNRIVKFVNAKFDG
VVPEYSTSIKDESFDFAAWVGDVQKLLDEYILDMDAVHLRSGVEKATAVSSQGNTLLQYR
LDNASLEKEPERTKAVIGYALSLCGLLASILSPFTPSTSDSIAEQLNVPLPLIPDTFDPG
FIKPGHKIGKAAYLFSRIDEKKVAEWKEKFGGTSETREAEAAAKAKKQADKDKRKAKKAA
SKAAEAAKQDGEAKPVDAATVATGEAKELPVREKPVEK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggctgactccgacaacgtcatccgtcccatcgagggcaagaagaacgttctgatcacc
agtgctctaccatacgtcaacaacgtgccgcacctcggcaacattatcggatcaacgctc
tcggccgactgtttctcccgctattccaagcagcgcggcaacccgacgctctacatctgc
ggtaccgacgagtacggaacggcaaccgagacaaaggccctcgaggagggtgtcacgccc
cgtgagctctgcgacaagttccacaagctgcacaagcagatctacgatgactttcagatc
aactttgactacttcggccgtaccagtacggacaaccacaccaagattgtccaggagatg
tttttacggctgtgggagaacaagttcctcgatgagcgcgtcaccacccagccttactgt
gagactcatggcgctttcttagccgaccgctttgtcgagggtacctgcccgcgctgtggt
tacgacgatgcccgcggcgaccagtgcgaccagtgcggtaacctgctcgacccttttgag
ctgatcaacccgcgctgcaaggtctgcaaagtcaaccagccgcccgtgcctcgggacacc
aagcacgtcttcctcgctctcgaccgcctccagcctcagatggacgagtggttcgccaag
gcaagcaaggagggcaagtggtcgcccaatgccattgctattaccaagtcgtggctggac
aagggtctggagggccgttcgattacgcgcgatctcaagtggggtgtgccggtgccgcta
ccgggctacgagggcaaggtgatttacgtgtggtttgatgcttgcattggctacccgtcc
attacgtcgtgctattcagagaaatactgggaggagtggtggaagaccggagacgttaag
ctgtaccagttcatgggcaaagacaacacaccgttccacgcggtgacgttcccttcgagc
cagctcggcaccggcgacaaatggaacatggtatacaacatttcgacgaccgagtacctg
aactacgagaacacaaagttctccaagtcgcgatcggtcggcgtgtttggtgaccaggca
aaggacacgggcatcccgacgtccgtgttccgctactacctactgagctcgcggcccgag
agcagcgacacgcagtttgagtggagctcatttgtgcaggccaacaactcgatcctgctg
gccaatatcggcaactttgtcaaccgcattgtcaagtttgtcaatgccaagtttgacggc
gtggtaccggaatactccacgtcgatcaaggacgagtcgtttgactttgccgcgtgggtc
ggtgatgtccagaagctgcttgacgagtacatcttggacatggacgccgtccacctgcgc
agcggcgttgagaaggccacggccgtctcgagccagggcaacacacttctgcagtaccgc
ctcgacaatgccagcctggagaaggaacctgagcgcaccaaagccgtcattggctatgcg
ctgtcactctgcggcctgctggcgtccatcctgtcgccattcacgccttcgacgtccgat
tcgattgccgagcagcttaacgttcccctgccgctgatcccggacacctttgatcctggc
ttcatcaagccgggccataagatcggcaaggctgcgtacctgttttcgcgtatcgacgag
aagaaggtggccgagtggaaagagaagttcggcggcacgtccgagacgcgggaggccgag
gccgcggccaaggcgaagaagcaggctgacaaggacaagaggaaggccaagaaggcggca
tctaaggcggccgaggccgcgaaacaagacggtgaggctaagcctgtcgacgcggcgacc
gtcgccacgggcgaggccaaggagctgccggtgagggagaagccggtggagaaatag

DBGET integrated database retrieval system