KEGG   Sporothrix schenckii: SPSK_07175Help
Entry
SPSK_07175        CDS       T05555                                 

Definition
(RefSeq) sphingosine kinase
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00600  Sphingolipid metabolism
ssck01100  Metabolic pathways
Module
ssck_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPSK_07175
Enzymes [BR:ssck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     SPSK_07175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 27669119
NCBI-ProteinID: XP_016590846
UniProt: A0A0F2MH36
Position
Unknown
AA seq 674 aa AA seqDB search
MSSDTATAAEAQVSSAGANGDAINGAASGAANGAANGINGTANDVSSTAIDPADIPQAPP
VPPTPSPPPTARTAKRQSHVVSFDKTLENTLKLQTHDFDIQDNDLVVVGMGAHCEVNFVL
RRTQDANGLPVSRQGKAQKEPPHMHELYVFHTTATQHQFSRSKANRNACCLPASAADYRL
SIPLYNVLWASVSDDNRRLVIDYAEVASKTRIRPAKFTVSLEPSGPDWPTPAEVAAWAEL
LRNRAYGDVPQRRRAYVLVNPHAGPGGAMKKWEHEARPLLDAARLSLTVVTTAYSGQAIE
LCTALDIDAYDMVLACSGDGLPHECFNGLGKRPDARRALEKVAVAHVPCGSGNAMACNLY
GSHHVSVAALAIVKGVVAPLDLASITYGETRLLSFLSQAVGVMAEVDLATENLRWMGSAR
FTWGFIERLLARKVYPCDLAVKVEIEHKDDVKAHYSRHQAPAKGSRTTGKSTGTSTIKAA
GKTSAAAAAESSATTTVAAADADAGAASGSGGDTSDQSLPPLQFGTVNDPLPDDWETIPE
DKMGNFFCGNMAYMAPDTSFFAAALMADGLMDLITIDGDISPAKSLGMLLTVEDNRLFDN
PLVRYRKISGFRLTPRNQKDGYISIDGERIPFSPFQAEVHKGLGRVIAKRATPGYEAPGP
LNWDKMAPVERIMA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgacacggctactgctgctgaagcgcaggtgagctcggccggcgcaaacggc
gatgctatcaatggagctgccagcggagctgccaacggagctgcgaatggaatcaatgga
accgccaacgacgtgtcctcgaccgccatcgaccctgccgacatcccccaggcccctcct
gttccgcctacaccgtcaccaccaccgacagcacgcactgccaagcgccagtcccacgtc
gtctcgtttgacaaaacactcgagaacaccctcaagctccagacacacgactttgacatc
caagacaacgaccttgttgtagttggtatgggtgcccactgtgaggtgaattttgtattg
cgaagaacacaagatgctaacggcctgcctgtgtccagacaaggcaaagcgcaaaaagaa
ccgccacacatgcatgagttgtatgtatttcacacaacggccacacagcaccagttctct
agatccaaagctaaccgcaatgcatgctgcctgccagcctccgccgccgactaccgcctc
tcgatccccctctacaatgtcctgtgggcctccgtgtccgacgacaaccgccgcctcgtc
atcgactacgccgaggtcgcctccaagacccgcatccggcccgccaagtttactgtctcg
ctcgagccatccgggcccgactggccgacgcccgccgaagtcgctgcctgggcggagctg
ctgcgcaaccgcgcgtatggcgacgtcccccagcggcggcgtgcctatgtgctggtcaac
ccgcacgccggtcccggcggcgccatgaagaagtgggagcacgaggcccgcccgctgctg
gacgctgcgcgtctgtccctcaccgtcgtcaccaccgcctactccggccaggccattgag
ctgtgcaccgccctcgacattgatgcgtacgacatggtcttggcctgttcgggcgacggc
ctgccgcacgagtgcttcaatggcctggggaagcggcccgacgcgcgccgcgcgctcgaa
aaggttgctgtggcccacgtgccctgcggcagcggcaacgccatggcctgcaacctctac
ggcagccaccacgtcagcgtcgccgccctggccattgtcaagggcgtcgtggcgcccctg
gacctggccagcatcacgtacggcgagacccgcctgctgagcttcctgagccaggccgtg
ggcgtcatggccgaggtcgacctggccacggagaacctgcgctggatgggcagcgcgcgc
ttcacgtgggggttcattgagcgcctgctggcccgcaaggtgtacccctgcgacctggcc
gtcaaggtcgagattgagcacaaggacgacgtcaaggcgcactactcgcgccaccaagcg
cccgccaagggaagccgcaccaccggcaagagcaccggcaccagcaccataaaagctgct
ggcaagacctcggccgcggcagcagcagaatcgtctgcgacaacgaccgttgccgccgct
gacgccgatgcaggcgctgcatctggcagcggcggcgacaccagcgaccaaagtttgccg
ccgctgcagtttggcaccgtcaacgacccgctgccggacgactgggagaccatccccgaa
gacaagatgggcaactttttctgcggaaacatggcgtacatggcccccgataccagcttc
tttgctgcggcgctcatggccgacggcctcatggacctcatcaccattgacggcgacatc
tccccggccaagtcgctcggcatgctcttgaccgtcgaggacaaccgcctgtttgacaac
ccgctcgtccgctaccgcaaaatctccggcttccgcctcacgccccgcaaccaaaaggac
ggctacatcagcatcgacggcgagcgcatccccttctcgcccttccaggccgaggtccac
aagggcctgggccgcgtcattgccaagcgcgcaacccccggctacgaagcaccgggcccg
ctgaactgggacaagatggcgcccgttgagcggatcatggcatag

DBGET integrated database retrieval system