KEGG   Sporothrix schenckii: SPSK_08625Help
Entry
SPSK_08625        CDS       T05555                                 

Definition
(RefSeq) heat shock 70kDa protein 1/8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ssck  Sporothrix schenckii
Pathway
ssck03040  Spliceosome
ssck04141  Protein processing in endoplasmic reticulum
ssck04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPSK_08625
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPSK_08625
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPSK_08625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssck01009]
    SPSK_08625
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ssck03041]
    SPSK_08625
   03009 Ribosome biogenesis [BR:ssck03009]
    SPSK_08625
   03110 Chaperones and folding catalysts [BR:ssck03110]
    SPSK_08625
   04131 Membrane trafficking [BR:ssck04131]
    SPSK_08625
   03051 Proteasome [BR:ssck03051]
    SPSK_08625
   03029 Mitochondrial biogenesis [BR:ssck03029]
    SPSK_08625
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssck04147]
    SPSK_08625
Protein phosphatases and associated proteins [BR:ssck01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SPSK_08625
Spliceosome [BR:ssck03041]
 Complex B
  Other components
   Prp19 complex
    SPSK_08625
 Complex C
   Prp19-CDC5 complex
    SPSK_08625
Ribosome biogenesis [BR:ssck03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    SPSK_08625
Chaperones and folding catalysts [BR:ssck03110]
 Heat shock proteins
  HSP70 / DNAK
   SPSK_08625
Membrane trafficking [BR:ssck04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    SPSK_08625
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SPSK_08625
Proteasome [BR:ssck03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SPSK_08625
Mitochondrial biogenesis [BR:ssck03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    SPSK_08625
Exosome [BR:ssck04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPSK_08625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 27670493
NCBI-ProteinID: XP_016588082
UniProt: A0A0F2MB59
Position
Unknown
AA seq 637 aa AA seqDB search
MAPAVGIDLGTTYSCVGIYRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQVAMN
PQNTVFDAKRLIGRKFADPEVQADMKHFPFKVADRAGKPVIEVEFKGETKQFTPEEISSM
VLIKMRETAESYLGGTINNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKVEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFV
NVSTNARALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCQDLFR
STLQPVDRVLTDAKIDKSQVHEIVLVGGSTRIPRIQKLITDYFNGKEPNKSINPDEAVAY
GAAVQAAILSGDTSSKSTNEILLLDVAPLSLGIETAGGMMTKLIPRNTTIPTKKSEVFST
FSDNQPGVLIQVFEGERQRTKDNNLMGKFELTGIPPAPRGVPQIEVTFDLDANGIMNVSA
VEKGTGKSNQIVITNDKGRLSKDDIERMLAEAEKFKEEDEAEGRRVAAKNGLESYAYSLR
NTLSDSKVDEKLDAADKEKLKGEIDRVVSWLDESQQATREEYEEHQKELEAVANPIMMKF
YGSGGAPGGAPDGAPGGFPGAAGGATHDDGPTVEEVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgccgtcggtatcgatcttggtaccacgtactcttgcgtgggtatctatcgt
gacgatcgcattgagatcattgccaatgaccagggtaaccgcactacgccgtctttcgtg
gccttcacggacacggagcggttgattggtgatgccgccaagaaccaagtcgccatgaac
ccccagaacacggtcttcgacgccaagcgtctgattggccgcaagttcgccgaccccgag
gtccaggccgacatgaagcacttccccttcaaggtcgccgaccgtgctggcaagcccgtc
attgaggtcgagttcaagggcgagaccaagcagttcaccccggaggagatttcctccatg
gttctcatcaagatgcgtgagaccgccgagtcctacctgggtggcaccattaacaacgcc
gtcgtcaccgtcccggcctacttcaacgactcccagcgccaggccaccaaggatgccggt
ctcattgccggcctcaacgtcctgcgcatcatcaacgagcccaccgccgccgccattgcc
tacggcctggacaagaaggtcgaaggcgagcgcaacgtcctgattttcgatctgggcggt
ggtacctttgatgtgtcgctgctcaccattgaggagggcatcttcgaggtcaagtcgact
gccggcgacactcacctgggtggtgaggactttgacaaccgcctcgttaaccactttgtt
aacgtcagcaccaacgcccgtgctctgcgccgcctccgcaccgcttgcgagcgtgccaag
cgcaccctttcgtcgtctgctcagacgtccatcgagatcgactctctgttcgagggcatc
gacttctacacctccatcactcgtgcccgcttcgaggagctgtgccaggacctgttccgc
tctaccctgcagcccgttgaccgtgtcctgacggacgccaagatcgacaagtcccaggtc
cacgagatcgtcctggtcggcggttccacccgcattccccgcatccagaagctgatcacc
gactacttcaacggcaaggagcccaacaagtccatcaaccccgatgaggctgttgcctac
ggcgctgccgtccaggctgccatcctcagcggtgacacctcgtccaagtccaccaacgag
atcctgctgctcgatgttgcccccctgtcgctcggtatcgagactgccggtggcatgatg
accaagctcattccccgcaacaccaccattcccaccaagaagtctgaggtcttctccact
ttctccgacaaccagcccggcgtgctgatccaggtctttgagggtgagcgccagcgcacc
aaggacaacaacctgatgggcaagttcgagctcaccggcatcccccccgcgccccgcggt
gttccccagatcgaggttaccttcgaccttgacgccaacggtatcatgaacgtctcggcc
gtcgagaagggcaccggcaagtccaaccagattgtcatcaccaacgacaagggccgcctg
tccaaggatgacatcgagcgcatgctcgcagaggccgagaagttcaaggaggaggatgag
gccgagggccgccgtgtcgctgccaagaacggccttgagtcgtacgcctactctctgcgc
aacaccctgagcgactccaaggtcgacgagaagcttgacgctgccgacaaggagaagcta
aagggcgagatcgaccgcgttgtcagctggctcgacgagagccagcaggctacccgcgag
gagtacgaggagcaccagaaggaactcgaggccgttgccaaccccatcatgatgaagttc
tacggctctggcggtgctcccggtggcgctcccgatggtgcccctggtggcttccccggt
gctgccggtggtgccacgcacgacgacggcccgaccgtcgaggaggtcgactaa

DBGET integrated database retrieval system