KEGG   Sporothrix schenckii: SPSK_09672Help
Entry
SPSK_09672        CDS       T05555                                 

Definition
(RefSeq) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
ssck  Sporothrix schenckii
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPSK_09672
Enzymes [BR:ssck01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     SPSK_09672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS FtsJ Methyltransf_32 Methyltransf_2 Methyltransf_4 PCMT Ubie_methyltran
Motif
Other DBs
NCBI-GeneID: 27671521
NCBI-ProteinID: XP_016588661
UniProt: A0A0F2MB05
Position
Unknown
AA seq 276 aa AA seqDB search
MSTSKDGKDGTDWSADQYLKFHDERTRAVHDLVHRGDTPLRIIDLGCGPGNSTAVLADRF
PGAQLSGVDSSPNMIAKARATLPGVAFGLADLRTYAPAPGAADLLLANAVFQWLSLAERL
PTVLRLFAALPPGGVFAYQVPDNKSEPTHQAMREVARGEAPGTSPSDPWVATLRELHDRD
PIETPEQIYDALIPHSQSVDVWHAVYNHVLVGGPKDIVEWVRGTGLQPWVNALPDEVTKQ
AFVAAYERRLGELYERRVDNSVIIRYPRLFVVAVKK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctccaaagacggcaaagacggcacggactggtcggccgaccagtacctcaag
ttccatgacgagcgcacgcgcgctgtccacgacctggtccaccgcggcgacacacccctc
cggatcattgaccttggctgcggcccgggcaactcgacggctgtcctggccgaccgcttc
cccggcgcgcagctgtcgggcgtcgactcgtcacccaacatgattgccaaggcgcgcgcg
accctgcccggcgtggcctttggcctggccgacctgcgcacgtatgcgccggcgcccggc
gcggccgacttgctgctggccaacgccgtgttccagtggctcagcctcgccgagcgcctg
ccgacggtgctgcgcctgtttgcggcgctgccgccgggcggcgtgtttgcgtaccaggtg
cccgacaacaagtcggagcccacacaccaggcgatgcgcgaggtggcccgcggcgaggcg
ccgggcacgtcgccgtcggacccgtgggtggcgacgctgcgcgaactgcacgaccgcgac
ccgatcgagacgcccgagcagatttacgatgcgctgatcccgcacagccagagcgtggac
gtgtggcacgcggtgtacaaccacgtgctggtgggcggccccaaggacattgtcgagtgg
gtgcgggggacgggtctgcagccgtgggtgaatgcgctgccggacgaggtgaccaagcag
gcatttgtggcagcatacgagcggcggctcggcgagctttacgagcggcgggtcgacaac
agtgtcatcattcgctacccgcggctgtttgtcgtggcagtcaagaagtaa

DBGET integrated database retrieval system