KEGG   Staphylococcus sciuri: CEP64_00175Help
Entry
CEP64_00175       CDS       T05176                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00020  Citrate cycle (TCA cycle)
sscu00620  Pyruvate metabolism
sscu01100  Metabolic pathways
sscu01110  Biosynthesis of secondary metabolites
sscu01120  Microbial metabolism in diverse environments
sscu01130  Biosynthesis of antibiotics
sscu01200  Carbon metabolism
Module
sscu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sscu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEP64_00175 (mqo)
   00620 Pyruvate metabolism
    CEP64_00175 (mqo)
Enzymes [BR:sscu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CEP64_00175 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ASE33066
Position
38236..39720
Genome map
AA seq 494 aa AA seqDB search
MDNNQPKDVILIGAGILSTTFGSFLKNIEPDWNIKLFERLEQPAIESSNEKNNAGTGHAA
LCELNYTVEQEDGSIDVERAKEINEQFEISKQFWSYLVKSKAIENPQEFIRPLPHISFVM
GIRNVDFLKRRYDALKSLPMFEGLTYTEDHKVLAEWMPLMMQGRNSNEPLAASKIDEGTD
VNFGELTRKLVKNIEKHENAQVHFRHEVVDFKQLSNSKWEVKVRNLETGKVETHVADYIF
IGAGGHAIPLLQKTKIPESRHLGGFPISGAFLVCNNPKVVSEHNAKVYGKEPPGTPPMTV
PHLDRRYIQGKESLLFGPFAAIGPKFLKNGSNLDLFKSINTSNVVTMLSSGVKNLSLVKY
SIQQVLQRKEDRMKELRRFVPDAKDEDWDIHIAGKRVQVIKDTEEHGRGFIQFGTEVVNS
EDHTVIALLGESPGASTSVSVALEVIEKNFPQYMEKWESKIKEIIPSYGESLIEDSALLK
KTRKQTAEALELNK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggataataaccaaccaaaagacgttattcttattggtgctggtattttaagtacgaca
tttggttcttttttgaaaaatattgaaccagattggaatattaagttattcgaaagatta
gaacaaccagctattgaaagttcaaatgaaaaaaataatgctggtacaggtcatgctgcg
ctatgcgaattaaactacacagttgagcaagaggacggttcaattgatgttgaaagagcg
aaagaaatcaacgagcaattcgaaatttctaagcaattttggtcatacttagttaagagc
aaagctatcgagaatccacaagaattcattagaccattaccacacatcagtttcgtaatg
ggtattcgaaatgtagatttcttaaaacgtcgttatgatgcattaaaatctctacctatg
tttgaaggcttaacttatacagaagatcataaagtattagctgaatggatgcctttgatg
atgcaaggtcgtaattcaaacgaaccacttgcagcaagtaaaattgacgaaggtacagat
gttaacttcggtgaattaacgcgtaaattagttaaaaatatcgaaaaacacgaaaatgca
caagttcatttccgtcatgaagtagtagactttaaacaactttctaatagtaaatgggaa
gttaaagttcgtaacttagaaactggtaaagtagaaacgcatgttgctgattatatcttt
atcggtgcaggcggacatgccattccattactacaaaaaacaaaaattcctgaaagtaga
catcttggaggattcccaattagtggtgcattcttagtatgtaacaaccctaaagtagta
agtgagcataatgccaaagtttatggtaaagagccacctggcacaccaccaatgactgta
cctcacttagacagacgttatattcaaggaaaagaaagtttactatttggtccattcgca
gcaatcggtccaaaattcttgaaaaatggatctaacttagatttatttaaatctattaat
acaagtaatgttgtgacaatgttatcttcaggtgttaaaaacttatcacttgtaaaatat
tcaattcaacaagtattacaacgtaaagaagatcgtatgaaagaattgcgtcgatttgta
ccagatgcaaaagacgaagattgggatattcatatcgctggtaaacgtgtacaagttatt
aaagatacagaagaacatggccgtggatttattcaattcggtacagaagttgtaaattca
gaagaccatactgtaattgctttattaggtgaatcaccaggagcatcaacatcagtatct
gtagctttagaagtaattgagaaaaacttccctcaatatatggaaaaatgggaatctaaa
attaaagaaatcatcccttcatatggagaatctttaattgaagactcagcattattgaag
aaaacacgtaaacaaacagcagaagctttagaattaaataaataa

DBGET integrated database retrieval system