KEGG   Staphylococcus sciuri: CEP64_04735Help
Entry
CEP64_04735       CDS       T05176                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00430  Taurine and hypotaurine metabolism
sscu00620  Pyruvate metabolism
sscu00640  Propanoate metabolism
sscu00680  Methane metabolism
sscu01100  Metabolic pathways
sscu01120  Microbial metabolism in diverse environments
sscu01200  Carbon metabolism
Module
sscu_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEP64_04735
   00640 Propanoate metabolism
    CEP64_04735
  09102 Energy metabolism
   00680 Methane metabolism
    CEP64_04735
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CEP64_04735
Enzymes [BR:sscu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CEP64_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ASE33900
Position
918662..919858
Genome map
AA seq 398 aa AA seqDB search
MTKIIAINAGSSSLKFQLFEMPEEKVITKGLIERIGLKNSIFTITVNGEKITRTLDIENH
EVAVNIMIEALKEHNIIEDINDIQGTGHRVVHGGELFPESALVTEDVLAKIESLTDLAPL
HNPANIMGIKAFRKLLPSIPHVAVFDTSFHQTMPEESYLYSLPYNFYKDFGIRKYGFHGT
SHKYVSERAAELLDRPLDQLRIISCHIGNGASIAAIDGGKSVDTSMGFTPLAGVTMGTRS
GNLDPALIPYIMEKTGKNAEEVLNILNKESGLLGISGSSSDLRDIEQDANEGNERAKLAL
DVFASRIHKYMGSYATRMHGLDAIVFTAGVGENSDTVRAKVLEGLEFMGVYWDQRLNTGL
RGEEAFINYPHSPVKVIVIPTDEEVVIARDVVKFGNLG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattatagcaattaatgctggtagctcatctttaaaattccaattatttgag
atgcctgaagaaaaagttatcacaaaaggattaatcgaacgtatcgggttgaaaaattca
attttcacaattacggttaacggggaaaaaattacaagaacattagacattgaaaatcat
gaagttgcagtaaacatcatgattgaagctttaaaagagcataatatcatcgaagacatt
aatgatattcaaggtactggacatcgtgttgttcacggcggagaattattcccagaatca
gcacttgttactgaagatgtattagctaaaatcgaatcattaactgatttagcgccttta
cacaacccagcaaacatcatgggtattaaagcatttagaaaattattgccaagtatccca
catgttgcagtattcgatacatcattccaccaaacaatgccagaagaatcatatttatac
agcttaccttacaacttctataaagatttcggtattcgtaaatatggtttccatggtaca
agtcataaatatgtatctgaaagagcagcagaattattagatcgtccattagatcaatta
agaattatctcttgtcatatcggtaatggtgcttctattgctgcaattgacggtggtaaa
tcagttgatacttcaatgggcttcacaccattagcaggtgttacaatgggtacgcgttca
ggtaaccttgacccagctttaattccatatatcatggagaaaactggtaaaaatgctgaa
gaagtattaaatatccttaataaagaatcaggtttacttggtatctcaggttcatcaagt
gacttaagagatattgagcaagacgctaacgaaggtaacgaacgtgctaaattagcatta
gatgtattcgcatctagaatccataaatatatgggatcatatgctacaagaatgcatggc
ttagatgcaattgtatttacagctggtgtaggggaaaactctgacacagttcgtgctaaa
gtattagaaggattagaatttatgggtgtatattgggatcaacgcttaaacacaggttta
cgtggagaagaagcattcatcaactacccacattcaccagtaaaagttattgtaattcca
actgacgaagaagttgtgatcgcacgtgacgttgtgaaatttggtaacttaggataa

DBGET integrated database retrieval system