KEGG   Staphylococcus sciuri: CEP64_06320Help
Entry
CEP64_06320       CDS       T05176                                 

Gene name
dapD
Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00300  Lysine biosynthesis
sscu01100  Metabolic pathways
sscu01110  Biosynthesis of secondary metabolites
sscu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CEP64_06320 (dapD)
Enzymes [BR:sscu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     CEP64_06320 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 Fucokinase
Motif
Other DBs
NCBI-ProteinID: ASE34207
UniProt: A0A1X0TXD5
Position
complement(1246953..1247672)
Genome map
AA seq 239 aa AA seqDB search
MVKDFTAEEIIQYISEAEKVTPLKVYVNGAFENVEFPESFKVFGSETSKTIFCDAKDWKS
FYEANQSAITDLEIEHDRRNSAIPLKDLTNTNARIEPGAFIREHAVIEDGAVVMMGATIN
IGAVVGEGTMVDMNATLGGRATTGKNVHVGAGSVLAGVIEPPSASPVVIEDDVLIGANAV
ILEGVRVGKGAIVAAGAIVTKDVPAGAVVAGTPAKVIKQSADVQDGKKEIVSALRNLNQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagattttacggcagaagaaattatacaatatattagtgaggcagagaaagta
acgcctttaaaggtttatgtaaacggcgcatttgaaaatgttgaattcccagagtcattt
aaagtatttggttctgaaacatctaaaacaattttctgtgatgctaaagattggaagagc
ttttatgaagcgaatcaatcagctattacagatttagaaattgaacatgatcgtcgcaat
tcagcaattccattaaaagacttaacgaatacaaatgcaagaatcgaaccaggtgctttc
attagagaacatgcagttattgaagacggtgcggttgttatgatgggtgctacaatcaat
atcggtgctgttgttggtgaaggtacaatggtagatatgaacgctactttaggtggacgt
gcaacaactggtaaaaatgtacacgttggtgctggatcagtattagcgggtgttattgaa
ccaccaagtgcatcacctgtagtaattgaagatgacgtattaatcggtgcaaatgctgtt
atccttgaaggtgttagagtcggcaaaggtgcaatcgttgcagctggtgctatcgtaact
aaagatgttccggctggcgcagtagtagctggtacaccggctaaagttattaaacaatca
gcagatgttcaagacggtaaaaaagaaattgtatctgctttacgtaatttaaatcaataa

DBGET integrated database retrieval system