KEGG   Staphylococcus sciuri: CEP64_09020Help
Entry
CEP64_09020       CDS       T05176                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00473  D-Alanine metabolism
sscu01100  Metabolic pathways
sscu01503  Cationic antimicrobial peptide (CAMP) resistance
sscu02020  Two-component system
Module
sscu_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CEP64_09020
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CEP64_09020
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CEP64_09020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sscu01504]
    CEP64_09020
Enzymes [BR:sscu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     CEP64_09020
Antimicrobial resistance genes [BR:sscu01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    CEP64_09020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ASE34723
UniProt: A0A1X0TYR6
Position
complement(1820783..1821019)
Genome map
AA seq 78 aa AA seqDB search
MNFEESVLNILAEVAENDIVKENPDIEIFEEGIIDSFATVGLLLEIQNNLGIDVTITDFD
RDEWATPNKIIAVLKELQ
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaagagagtgttttaaatattttagcagaagttgcagaaaatgatatcgtt
aaagaaaatcctgatattgaaatatttgaagaaggcattatcgattcatttgcgacagta
gggttattattagaaattcaaaataatttaggcattgatgtaacaattactgattttgat
agagatgagtgggcaacaccaaataaaattatagcagtacttaaggaattacaatga

DBGET integrated database retrieval system