KEGG   Staphylococcus schleiferi 2317-03: RN70_11105Help
Entry
RN70_11105        CDS       T04520                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sscz  Staphylococcus schleiferi 2317-03
Pathway
sscz00071  Fatty acid degradation
sscz00280  Valine, leucine and isoleucine degradation
sscz00310  Lysine degradation
sscz00362  Benzoate degradation
sscz00380  Tryptophan metabolism
sscz00620  Pyruvate metabolism
sscz00630  Glyoxylate and dicarboxylate metabolism
sscz00640  Propanoate metabolism
sscz00650  Butanoate metabolism
sscz00900  Terpenoid backbone biosynthesis
sscz01100  Metabolic pathways
sscz01110  Biosynthesis of secondary metabolites
sscz01120  Microbial metabolism in diverse environments
sscz01130  Biosynthesis of antibiotics
sscz01200  Carbon metabolism
sscz01212  Fatty acid metabolism
sscz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sscz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RN70_11105
   00630 Glyoxylate and dicarboxylate metabolism
    RN70_11105
   00640 Propanoate metabolism
    RN70_11105
   00650 Butanoate metabolism
    RN70_11105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RN70_11105
   00072 Synthesis and degradation of ketone bodies
    RN70_11105
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RN70_11105
   00310 Lysine degradation
    RN70_11105
   00380 Tryptophan metabolism
    RN70_11105
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RN70_11105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RN70_11105
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RN70_11105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sscz04147]
    RN70_11105
Enzymes [BR:sscz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RN70_11105
Exosome [BR:sscz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RN70_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKS74411
UniProt: A0A0K1AFZ3
Position
complement(2333010..2334152)
Genome map
AA seq 380 aa AA seqDB search
MTKAVIVAAKRTPIGVYGGLLKRWEPEALLKPLFEYFVENLPCPLDELDDVIIGNIVGKG
GNIARKSLLEAGIDVSIPGLTVDRQCGSGLEAIHLACRLIESGAGDFYIAGGVESVSRAP
WKMEKPTSLYPSSPPTFYERAPFAPEGQDPSMIEAADNVAKQYHVTREDQDRFAVQSHHR
TSQAIAKGVIEPEILPLSVNGQQMLHDESVKPKIQYERIARLKPLREGGTVTVGNCCLKH
DGACLVVVMSEQKARQLGLTQGLAFVDYAMVGVDPNLLGIGPVPAVKRILEQQQLTIEQI
DAVELNEAFSSQVLASQRELDIRNDQLNRFGGAIAMGHPYSASGAILVTRLFYMMDAHRT
IATMGIGGGMGNAALFERWA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagcagtcattgtagcagcgaaacggacacctattggcgtttatggagggtta
ttaaagagatgggaaccagaagcattattaaaaccattatttgagtattttgtggaaaat
ttaccgtgtccgctcgatgaacttgatgatgtaatcattggaaatattgttggcaaagga
gggaatattgcacgcaaaagtttattagaagcgggcatcgatgtgtcgattcctggactt
acagttgatcgacaatgtggttcgggtttagaagccattcatttagcatgtcggttgatt
gaaagtggcgcgggagatttttacatcgctggtggcgtagagagtgtgagtcgtgcgccc
tggaaaatggaaaaaccgacatcattatatccttccagtcccccaactttttatgaacgc
gcaccatttgcgccagagggtcaagatccgagtatgattgaagccgccgacaatgtcgca
aaacaataccacgtgacaagagaagaccaagatcggtttgcggttcaaagtcatcaccgc
acgagccaagcgatagcgaagggtgtcatagaacctgaaatattaccgctttctgtaaat
ggacagcagatgcttcatgatgaaagtgtaaagccgaaaatccaatatgaacgtatcgca
cgtttaaaaccgctacgtgaaggcggtactgtaacagtcggtaattgttgtcttaaacat
gacggagcatgtttagttgtagtgatgtctgaacaaaaagcacgtcaactcggtttgaca
caaggattagcatttgttgattatgcgatggtcggtgttgatcccaatctattagggata
ggtccagttccagcagtaaagcgcattctagaacagcaacaactgacaatcgaacaaatt
gatgctgtagagttaaatgaagcgttcagttcacaagtgcttgcatcacagcgagagcta
gacattcgcaatgaccaactcaatcgttttggcggtgccattgcgatgggacacccttat
agtgcaagcggggccattttagtcactcgattattttatatgatggatgcgcacagaacc
attgctacgatggggattggaggcggtatgggtaatgcagcgttatttgaacgttgggcg
taa

DBGET integrated database retrieval system