KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0494Help
Entry
SPSINT_0494       CDS       T01396                                 

Definition
(GenBank) Carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Brite
Enzymes [BR:ssd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SPSINT_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 DLH Abhydrolase_6 BAAT_C DUF2048 Abhydrolase_5 Esterase PhoPQ_related UPF0227 DUF4611 Abhydrolase_3 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: ADV05023
Position
541459..542199
Genome map
AA seq 246 aa AA seqDB search
MKIQLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPHYEGHAAPPEEI
LQSSPHVWYKDVLDGYEFLVEHGYDEIAVAGLSLGGVFALKLSLNRTVKGIVTMCSPMYI
KTEGAMYEGVLDYARQFKKYEGKDDETIEREMAAFHPTDTLRELQGTIQEVRDSVDEVID
PILVIQAEQDEMINPDSANVIYDEVMSDEKRISWYKESGHVITIDKEKEAVFEDVYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcaattaccgaaacctttcttttttgaggaaggaaaacgtgcagtattatta
ttacacggttttactggcaacagttcagatgtgagacaattaggacgctttttacagaaa
aaagggtacacctcttatgcacctcattatgaaggacatgcggccccaccagaagaaata
ttgcaatcgagtcctcatgtatggtataaagatgtgctcgatggttatgaatttttagtg
gaacacggttatgacgaaatcgctgtcgctggtttatcattaggtggcgtttttgcatta
aaactaagcttaaatcgtactgtaaagggtattgtaacgatgtgctcaccgatgtacatt
aaaacggaaggggccatgtatgaaggtgtactagactatgcccgtcaatttaaaaaatat
gaaggtaaagatgacgaaacgattgagcgcgaaatggcagcgtttcatccgactgacacg
ttgagagagttacaagggacgattcaagaagtgcgcgacagtgtggatgaagtaattgat
cctattttagtgatacaggctgaacaagatgagatgattaatccagattctgctaatgtc
atttatgatgaagtgatgtcggatgaaaaacgaatttcttggtacaaagaatctggtcac
gtcattactattgataaagaaaaagaagcagtatttgaagatgtttatcaatttttagag
tcattagattggtctgaataa

DBGET integrated database retrieval system