KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0643Help
Entry
SPSINT_0643       CDS       T01396                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00250  Alanine, aspartate and glutamate metabolism
ssd00330  Arginine and proline metabolism
ssd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPSINT_0643
   00330 Arginine and proline metabolism
    SPSINT_0643
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SPSINT_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Con-6
Motif
Other DBs
NCBI-ProteinID: ADV05172
Position
655969..657513
Genome map
AA seq 514 aa AA seqDB search
MIPYQHEPFTDFTKEENREAYFRALEKVESELGKDYPLIIGGERVFTEDKTRVYNPSNRE
ETIGYVSKATKEHAQQALDAAKEAFKSWRKVDPKVRANILFRAAEITRKRKHEFSALLSK
EGGKPWKEADADTAEAIDFMEYYGRQMLELKDGKHVNSRPGEYNQFDYLPVGVSVVISPW
NFAYAIMAGTTSAPLVTGNTVLLKPSSNTPIISYKFMEVLEEAGLPKGVVNWIPGSSSEI
GDFLIENKDVGLISFTGSKKVGKEIIQKASVIQEGQNHIKRVIAEMGGKDAIIVDNEADL
QVATDAIVYSAFGFSGQKCSACSRVIAHQDIYDELLERVKEATEKIKVGNAAEPDTYVGP
VIDQKSLDKIKNYIEIGKGEGRLVTGGNTDEAVGNFVYPTIFADLDPNSRVMQEEIFGPV
VGFTKVKDFDEAIDVANDTEYGLTGAVISNNRMKLEQARRDFMVGNLYFNRGCTGAVVGY
QPFGGFKMSGTDSKAGGPDYLVLHMQGRSVSEHL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgattccatatcaacacgaaccatttacagattttacgaaagaggaaaatcgcgaggct
tattttcgtgcattagaaaaggttgaaagcgaactcgggaaagattatccactcattatt
ggtggagagcgcgtattcactgaagataaaacacgtgtttacaatccttcaaatcgcgaa
gaaacaatcgggtatgtttcaaaagcaacgaaagaacatgcacaacaagcgttagatgca
gcgaaagaagcgtttaaatcttggagaaaagtagatccaaaagtacgcgcaaatatttta
ttcagagctgctgaaattacacgtaaacgtaagcatgaattctctgcattactttcaaaa
gaaggtggtaaaccttggaaagaagcagatgcagatacagcagaagcgattgactttatg
gaatattatggtcgtcaaatgcttgagcttaaagacggtaaacatgtaaacagtcgtcct
ggtgaatacaatcagtttgactacttacctgtaggtgtcagtgttgttatttctccatgg
aactttgcctatgcgattatggcgggtacaacgtcagcaccacttgtaacaggaaacaca
gtattattaaaaccatcttctaatacaccaattatttcttataaatttatggaagtttta
gaagaagctggtttaccaaaaggggttgtgaactggattcctggttcttcaagtgaaatt
ggtgacttcttaattgaaaacaaagatgtgggcctcatttcatttacaggttctaaaaaa
gtcggtaaagaaattatccaaaaagcatctgtcattcaagaaggtcaaaatcatattaaa
cgtgtcattgctgaaatgggtggtaaggatgcgattatcgtcgacaacgaagcggattta
caagttgcgacagatgctattgtctactcagcgttcggtttctctggccaaaaatgttca
gcatgttcacgtgttatcgcgcatcaagacatttatgatgaattgttagagcgcgttaaa
gaagcaactgaaaaaattaaagtaggtaatgctgcagagccagatacgtatgtcggacca
gtcattgaccaaaaatctttagacaaaattaaaaactacatcgaaattggtaaaggtgaa
ggccgtcttgtaacaggtggtaatacagatgaagcagtcggtaactttgtctatccaact
atctttgctgatttagatccaaattcacgcgtgatgcaagaagaaattttcggaccagtt
gtcggtttcactaaagttaaagactttgatgaagcaattgatgtcgcaaatgatacagaa
tacggtttaacaggtgccgtgatttcaaacaaccgtatgaagttagaacaagcgcgtcgt
gactttatggtcggcaacctttactttaaccgtggctgtacaggtgcagttgtcggttac
caaccatttggtggcttcaaaatgtctggtacagactcaaaagcaggcggaccagactac
ttagtattacacatgcaaggtcgttcagtatcagaacatctataa

DBGET integrated database retrieval system