KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0804Help
Entry
SPSINT_0804       CDS       T01396                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00010  Glycolysis / Gluconeogenesis
ssd00020  Citrate cycle (TCA cycle)
ssd00620  Pyruvate metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
Module
ssd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_0804
   00020 Citrate cycle (TCA cycle)
    SPSINT_0804
   00620 Pyruvate metabolism
    SPSINT_0804
Enzymes [BR:ssd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPSINT_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N ATP-synt_ab_Xtn DUF896 BSP_II
Motif
Other DBs
NCBI-ProteinID: ADV05332
Position
846071..847372
Genome map
AA seq 433 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLCEVQNDKSVVEIPSPVSGTVLEVL
VEEGTVAVVGDIIVKIDAPDAEEMEFKGGHSNDAPAKAEEAKEEAPQEEAAPAAQEAVEV
DENRQVKAMPSVRKYARDNNVNIKAVNGTGKNGRITKEDVDAYLNGGEQAATAQDTASAE
SSEASTAPAASAPAVSTEGEFPETTEKISAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEVVQKHYWNIGIA
ADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTSDEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatattggtgaaggtatccacgaaggtgaaatcgta
aagtggttcgttaaagctggagacactattgaagaagatgacgtactatgtgaagtacaa
aatgataaatcagttgtagaaatcccatcacctgtaagtggtacagtacttgaagtgtta
gttgaagaaggtactgtagctgttgtaggtgacatcattgttaaaatagatgcacctgac
gctgaagaaatggagttcaaaggcggacatagtaatgatgcgcctgcaaaagctgaagaa
gctaaagaagaagcacctcaagaagaagcggcaccagctgctcaagaagctgtagaagtg
gatgaaaacagacaagtaaaagcaatgccatcagtgcgtaaatatgcacgtgacaataat
gtgaacattaaagctgttaatggtacaggtaaaaatggtagaattactaaagaagatgta
gatgcatacttaaatggtggcgaacaagcagcgacagctcaagatactgcatcagctgaa
tcttcagaagcatcaactgcaccagcagcatcagcaccagcagtttcaactgaaggtgaa
ttccctgaaacaactgagaaaatctctgcaatgcgtaaagcaatcgcaaaagcaatggtg
aactctaagcatactgcacctcacgtaacattaatggacgaaattgatgttcaagagtta
tgggatcaccgtaagaaattcaaagaaattgcagctgaacaaggtactaaattaacattc
ttaccttatgttgttaaagctttagtatcagcattgaaaaaatacccagcacttaacact
tcatttaacgaagaagctggcgaagttgtacaaaaacattactggaacattggtatcgca
gcagacactgacagaggtcttttagtacctgttgttaaacatgctgaccgtaaatcaatc
ttccaaatctcagatgaaattaacgaacttgctgtcaaagctcgtgacggtaaattaaca
tctgacgaaatgaaaggtgcaacatgtacaattagtaacatcggttctgcaggtggccaa
tggttcacaccagttatcaaccacccagaagttgcaatcttaggtattggtcgaatcgct
caaaaaccaatcgttaaagatggcgaaatcgttgcagcacctgtgttagcattatcacta
agctttgaccacagacaaattgatggtgcaactggtcaaaacgcaatgaaccacatcaaa
cgtttattaaacaatccagaactattattaatggaggggtaa

DBGET integrated database retrieval system