KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0900Help
Entry
SPSINT_0900       CDS       T01396                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ssd03009]
    SPSINT_0900
Enzymes [BR:ssd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SPSINT_0900
Ribosome biogenesis [BR:ssd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SPSINT_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Ub-Mut7C S4_2 DUF4832
Motif
Other DBs
NCBI-ProteinID: ADV05428
Position
940952..941869
Genome map
AA seq 305 aa AA seqDB search
MEKHIFNIEDATHHLQRIDKILPEFNSEWSRSQLQEWIKEGLIEVNGKAVKSNYKLKLGD
RIEITEKEVVEADIQAENLNLDIYYEDDDVAIVYKPKGMVVHPSPGHYTGTLVNGLMYQI
KNLSGINGEIRPGIVHRIDKDTSGLLMVAKNDVAHRSLVEQLMAKTVKRKYIALVHGHIP
HEFGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVIETFKNYTLVECELETGRTHQIRVH
MKYIGYPLVGDPKYGPKKTLEIGGQALHAGLIGFEHPKTGEYIERFAPLPAEFEAVIEQV
RKEDI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacatatatttaatattgaagacgcaacgcatcatttacagcgtattgacaaa
atattgcctgaattcaattcggagtggtcacgcagtcaattacaagagtggattaaagaa
ggattaattgaagttaatggtaaagctgtcaagtcgaactataaactaaaattaggtgac
cgtatagaaatcactgaaaaagaagtggtagaagcagatattcaagcagagaacttaaat
ttagacatttactacgaagatgacgacgtggcgattgtttataaacctaaaggcatggtc
gttcacccatcgccagggcattatactgggacgcttgtaaatggtttaatgtatcaaatc
aaaaatttatcaggtattaacggtgaaattcgtccaggtatcgtgcaccgtatcgataaa
gatacttcagggttactgatggttgcgaaaaatgacgtggcacatcgcagtttagttgaa
caattgatggcaaaaactgtgaaaagaaagtatattgcgctcgtacatggccatattcca
catgagtttggaacgattgatgcacctatcggacgcaataaaaatgaccgtcaatcgatg
gctgtcgttgatgacggtaaagaagctgtgacgcattttaatgtcattgaaacgtttaaa
aactatacattggttgaatgtgaactagaaacaggacgtacgcaccaaattcgtgtgcat
atgaagtatatcggttatccgcttgtaggcgatccgaaatatggtccgaaaaagacgtta
gaaataggcggacaagctttacatgcgggtcttatcggttttgaacatcctaaaacaggg
gaatacattgaacgttttgcgccgcttcctgcagaatttgaagctgtcattgaacaagtg
cgtaaagaagatatttaa

DBGET integrated database retrieval system