KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0903Help
Entry
SPSINT_0903       CDS       T01396                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00240  Pyrimidine metabolism
ssd00250  Alanine, aspartate and glutamate metabolism
ssd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPSINT_0903
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPSINT_0903
Enzymes [BR:ssd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SPSINT_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace zinc-ribbon_6 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADV05431
Position
944171..945049
Genome map
AA seq 292 aa AA seqDB search
MQHLVSMEHLAVEEIENLIQKAMQYKAGEAVPNLKGRYIANLFFENSTRTKCSFEMAEHR
LDMKQINFESSASSVQKGESLYDTCRTLQSIGCDALVIRHEQNHYYEPLLNMGIPIINAG
DGSGQHPTQSLLDLMTIYETYGRFEGLKVVICGDIKNSRVARSNYHSLTALGAKVVFSSP
DVWKDDSMAADYVELDDVIDEVDIVMLLRVQHERHAGVSQGFEKEEYHRRYGLTEERYAT
LQDHAIVMHPAPVNRDVEIADTLVEAPKSRIFEQMSNGVYIRMAVLTEILNG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatctcgtatcaatggaacatttagctgtagaagaaattgaaaacttaattcaa
aaagcgatgcagtataaagcaggagaagcggtaccgaatttgaaaggacgttacattgcg
aacttgtttttcgaaaattcgacacgtacgaaatgtagttttgaaatggcagaacaccgt
ttggatatgaagcaaatcaactttgaatcaagtgcctcttctgtacaaaaaggggaatcg
ctgtatgacacatgccgaacattacaaagcattggctgtgatgcacttgtcatccgacac
gaacaaaatcattactacgaacccttgttgaatatggggattccgattattaatgcaggg
gatggcagtggccagcatccgacgcaaagcttattggacttaatgacgatttacgaaaca
tatggtcgttttgaaggactaaaagtggtcatttgcggtgacattaaaaactcacgagtg
gcacgtagtaattaccatagtttaactgcacttggtgcaaaggtcgttttctcaagtcct
gacgtttggaaagatgacagcatggctgcagattacgttgaattagatgatgtgattgac
gaggtcgacattgtaatgttattacgtgtccaacatgaacgacatgcaggcgtttcacaa
ggttttgaaaaagaagaatatcaccgtcgttatggtttgactgaagaacgatatgccaca
cttcaagatcatgcgattgtgatgcaccccgcaccagtaaatcgcgatgtagaaattgca
gatacattagtagaagcaccgaagtcacgtatttttgaacagatgtcaaatggtgtgtac
ataagaatggcagtattaactgaaattttaaatggttaa

DBGET integrated database retrieval system