KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1483Help
Entry
SPSINT_1483       CDS       T01396                                 

Definition
(GenBank) 6'-aminoglycoside N-acetyltransferase (AAC(6')) / 2''-aminoglycoside phosphotransferase
  KO
K19883  bifunctional aminoglycoside 6'-N-acetyltransferase / aminoglycoside 2''-phosphotransferase [EC:2.3.1.82 2.7.1.190]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ssd01504]
    SPSINT_1483
Enzymes [BR:ssd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.82  aminoglycoside 6'-N-acetyltransferase
     SPSINT_1483
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     SPSINT_1483
Antimicrobial resistance genes [BR:ssd01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    SPSINT_1483
   O-Phosphotransferases
    SPSINT_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Acetyltransf_8 Acetyltransf_1 Acetyltransf_3 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: ADV06011
Position
complement(1534230..1535669)
Genome map
AA seq 479 aa AA seqDB search
MNIVENEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDEVFR
VIIEYNNVPIGYGQIYKMYDELYTDYHYPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLI
FEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRYD
DNATNVKAMKYLIEHYFDNFKVDSIEIIGSGYDSVAYLVNNEYIFKTKFSTNKKKGYAKE
KAIYNFLNTNLETNVKIPNIEYSYISDELSILGYKEIKGTFLTPEIYSTMSEEEQNLLKR
DIASFLRQMHGLDYTDISECTIDNKQNVLEEYILLRETIYNDLTDIEKDYIESFMERLNA
TTVFEGKKCLCHNDFSCNHLLLDGNNRLTGIIDFGDSGIIDEYCDFIYLLEDSEEEIGTN
FGEDILRMYGNIDIEKAKEYQDIVEEYYPIETIVYGIKNIKQEFIENGRKEIYKRTYKD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagttgaaaatgaaatatgtataagaactttaatagatgatgattttcctttg
atgttaaaatggttaactgatgaaagagtattagaattttatggtggtagagataaaaaa
tatacattagaatcattaaaaaaacattatacagagccttgggaagatgaagtttttaga
gtaattattgaatataacaatgttcctattggatatggacaaatatataaaatgtatgat
gagttatatactgattatcattatccaaaaactgatgagatagtctatggtatggatcaa
tttataggagagccaaattattggagtaaaggaattggtacaagatatattaaattgatt
tttgaatttttgaaaaaagaaagaaatgctaatgcagttattttagaccctcataaaaat
aatccaagagcaataagggcataccaaaaatctggttttagaattattgaagatttgcca
gaacatgaattacacgagggcaaaaaagaagattgttatttaatggaatatagatatgat
gataatgccacaaatgttaaggcaatgaaatatttaattgagcattactttgataatttc
aaagtagatagtattgaaataatcggtagtggttatgatagtgtggcatatttagttaat
aatgaatacatttttaaaacaaaatttagtactaataagaaaaaaggttatgcaaaagaa
aaagcaatatataattttttaaatacaaatttagaaactaatgtaaaaattcctaatatt
gaatattcgtatattagtgatgaattatctatactaggttataaagaaattaaaggaact
tttttaacaccagaaatttattctactatgtcagaagaagaacaaaatttgttaaaacga
gatattgccagttttttaagacaaatgcacggtttagattatacagatattagtgaatgt
actattgataataaacaaaatgtattagaagagtatatattgttgcgtgaaactatttat
aatgatttaactgatatagaaaaagattatatagaaagttttatggaaagactaaatgca
acaacagtttttgagggtaaaaagtgtttatgccataatgattttagttgtaatcatcta
ttgttagatggcaataatagattaactggaataattgattttggagattctggaattata
gatgaatattgtgattttatatacttacttgaagatagtgaagaagaaataggaacaaat
tttggagaagatatattaagaatgtatggaaatatagatattgagaaagcaaaagaatat
caagatatagttgaagaatattatcctattgaaactattgtttatggaattaaaaatatt
aaacaggaatttatcgaaaatggtagaaaagaaatttataaaaggacttataaagattga

DBGET integrated database retrieval system