KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1906Help
Entry
SPSINT_1906       CDS       T01396                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPSINT_1906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssd03011]
    SPSINT_1906
Ribosome [BR:ssd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SPSINT_1906
  Bacteria
    SPSINT_1906
  Archaea
    SPSINT_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 BAT
Motif
Other DBs
NCBI-ProteinID: ADV06434
Position
complement(1978554..1978907)
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKDVREAVAILKLTNKASSPVVEKLLMSALANAEH
NYGMNTDQLVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGQEEAQEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaactatcagaatcgcacctcgtaaagttcgattagta
ttggatctcattcgaggtaaagacgtaagagaagcagtagctattttgaaattaacaaat
aaagcttcttctccagtagtagaaaaattattaatgtccgctttagctaatgcagagcac
aactatggtatgaacactgatcaattagttgttaaagaagcatacgctaacgaaggacca
acattgaaacgtttccgtccacgtgcacaaggacgtgcaagcgcaattaacaaaagaaca
agtcatatcactatcgtagtaagtgatggacaagaggaagctcaagaagcttaa

DBGET integrated database retrieval system