KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2114Help
Entry
SPSINT_2114       CDS       T01396                                 

Definition
(GenBank) lipoprotein, NLP/P60 family
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP
Motif
Other DBs
NCBI-ProteinID: ADV06642
Position
complement(2202856..2203857)
Genome map
AA seq 333 aa AA seqDB search
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKY
AKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLA
SSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIP
INGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKYEGWRYVYGGASPTTSFDC
SGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVFFHSTYNAGSYITHVGIYLG
NNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaaaactttagtgattggtggttctggattattcttgatggtcttctcactg
cttctgtttgttgccattttattttcagatgaacaggacagcggaatttccaatattcat
tatggaggtgtgaatgtttccgcagaagtgctggctcataagcctatggtagaaaaatat
gccaaagaatatggcgttgaagaatatgtcaacatacttcttgcgattatacaggtggaa
tcgggcggtactgcggaagatgttatgcagtcctcggaatccctcggtcttccacctaat
tcattgagtacagaagaatccattaagcaaggtgtgaagtatttcagtgaattattagcc
agtagcgaaaggctcagtgtagatttagaatcggttatccagtcctacaattatggtggt
ggtttcttagggtatgtggctaatcgtggaaataaatatacctttgaactggctcaaagt
ttctcaaaagagtattcaggtggcgaaaaagtgtcttaccccaatcccatagccatacct
atcaatgggggctggcgatacaactatggcaatatgttttatgtgcaactggtaacgcag
tatcttgtcacaacagagtttgatgatgatacggtacaagccatcatggacgaagcactg
aaatatgagggctggcgatacgtttacggtggagcttccccgactacttcttttgattgt
agcggactgacacaatggacgtatggaaaagctggaattaacttaccacgaaccgcacaa
cagcaatatgatgtgacccagcatatcccactatcggaagcacaagctggcgatttggtt
ttctttcattctacctataacgctggctcttatattactcatgttgggatataccttggc
aataaccgtatgtttcatgcaggcgacccaatcggttatgccgacttaacaagcccctac
tggcaacagcatttagtgggagcaggacgaatcaaacaatga

DBGET integrated database retrieval system