KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2116Help
Entry
SPSINT_2116       CDS       T01396                                 

Definition
(GenBank) hypothetical protein
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 TBCC_N
Motif
Other DBs
NCBI-ProteinID: ADV06644
Position
complement(2206034..2208481)
Genome map
AA seq 815 aa AA seqDB search
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHA
LQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLL
NDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFK
IRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQR
YLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALS
TVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYKLSYVVRVSAN
DLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFA
NNLIVYYAVLYGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMK
NPKDSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLS
TSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMEL
LSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVY
FVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQC
LISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcatatccaattaaatacattgaaaacaatctcgtctggaataaagacggggaatgt
tatgcttactatgagcttgttccttacaattactcatttctaagtccagaacagaaaata
caagtgcatgattctttcagacagcttatcgcacaaaatcgtgatggcaaaattcatgct
ttacaaatcagtacagaatccagcatacgttctgcacaagagcgttccaaaaatgaagtc
actggcaagctcaaagcggttgcctatgacaaaatcgaccaacagacagacgctttaata
tccatgattggcgaaaatcaagtgaactaccgtttctttatcggctttaagttgcttctc
aacgatcaggagttttctatgaaaagtcttaccgttgaagcaaaaaatgctttgtctgat
tttgtctatgatgtgaaccataagctgatgggcgattttgttagtatgagtaatgatgaa
atcctgcgttttcagaagatggaaaagctcttagaaaataaaatctctcgtcgtttcaaa
atccgcaggttagataaggacgacttcggctatctgattgaacacctttacggacagaca
ggcactgcctatgaagagtatgagtaccatctatcaaagaaaaagctggataatgaaacg
ctgattaaatactatgacttgattaagcctactcgctgtttggtggaagaaaaacagcga
tatttgaaaatccagcaggaagatgaaaccgtctatgtagcttactttaccattaacagc
attgtcggagaactggacttcccgtcctctgaaatcttctactaccagcaacagcaattt
acattcccgattgatacgtcaatgaatgtggaaattgtagcgaatcgtaaagccctatct
actgtccgcaataaaaagaaagaactgaaagacttggataaccacgcttggcaaagtgat
aatgaaaccagctccaatgtggcggaagctctggaaagtgtgaatgagctggaaaccaat
ttagaccaaagcaaggaatctatgtacaagctgtcttatgtggtaagggtatcagcaaat
gatcttgacgaactcaaacgtcgttgtaatgaagtgaaagatttttatgacgatttaagc
gtaaaactggtacgaccatttggggatatgctcggcttacatgaagaatttttacctgcc
agcaagcgttatatgaatgattatattcaatacgtgacctctgatttcctcgctggttta
ggttttggtgctactcaaatgctgggggaaaatgaggggatttatgttggctacagctta
gatactggacgcaatgtctatctgaaacctgctcttgccagtcaaggggttaagggttca
gtaaccaatgcgttagcgtcggcttttgttggttcgctgggtggtggtaaatcctttgcg
aataaccttatcgtctattatgcggtgctttatggggcacaagcagtgattgtagaccca
aaagcagaacgtggcagatggaaagaaaccttgccagagatttcccatgaaatcaatatc
gtcactctgacttctgatgagaaaaacaaaggcttacttgacccttatgtgattatgaaa
aatcccaaagattctgaatcactggctattgatattctgacattccttacggggatttcc
tctcgtgatggggaacgcttcccaatccttagaaaagccattcgtgcagtaaccaatagt
gaagtacgagggttgatgaaagtgattgaggaattacgggttgagaatacgccactaagt
accagtatagccgaccatatcgaaagttttacagactatgactttgcacatttattattc
agtaatggttatgtggagcagtctatcagcttagaaaaacaactgaacattatacaggtt
gcggacttggtacttcccgacaaggaaacttcctttgaggaatataccactatggagctt
ttatccgttgctatgctgattgtcattagtacctttgctttagactttatccatacagac
cgaagcattttcaagattgtagatttagacgaagcatggagctttttacaggtagcacaa
ggaaaaacactatctatgaagctggttcgggctggtcgtgctatgaacgctggggtatat
ttcgtgacccaaaatacagacgacctcttagatgaaaaactgaaaaataacctcggctta
aaatttgcatttcgttccactgaccttaacgagattaaaaagaccttagccttttttggt
gtagacccagaggacgaaaacaatcagaagcgattgcgtgatttggaaaacgggcaatgc
cttatcagtgatttatatggtcgtgtcggtgtgatacagttccaccctgtatttgaagaa
ctgctccatgcctttgataccagaccacctgtgcgaaaagaggtgtaa

DBGET integrated database retrieval system