KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_2304Help
Entry
SPSINT_2304       CDS       T01396                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00020  Citrate cycle (TCA cycle)
ssd00620  Pyruvate metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
Module
ssd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSINT_2304
   00620 Pyruvate metabolism
    SPSINT_2304
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SPSINT_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ADV06832
Position
2437986..2439479
Genome map
AA seq 497 aa AA seqDB search
MPTQSEPKDIVIIGAGVLSTTFASMIKDLEPEWNLKLYERLDSPGVESSNERHNAGTGHA
ALCELNYTVKQPDGSIDIEKAKEINEEFEISKQFWSHLVKSKNIDTPRDFINPLPHISFV
RGKNNVQFLKDRYNKMKDFPMFDNIEYTEDIEVMRKWMPLMMQGRSASDIMAASKIDEGT
DVNFGELTRKMAKSIEAHKNADVHYNHEVRDFNRRKDGKWEVTVVNRNTGESHVQLADYI
FIGAGGGAIPLLQKTGIPESKHLGGFPITGQFLMCTNPDVIEEHGVKVYGKEPPGTPPMT
VPHLDTRYINGRKALLFGPFASIGPKFLKNGSNLDLFKSVKPYNITTLLAAAVKNLPLIK
YSIDQILMTKEGCMNHLRTFYPEAKDQDWELYTAGKRVQVIKDTEEYGKGYIQFGTEVVN
SQDHTVIALLGESPGASTSVSVALEVLERNFAEYVPEWTPKLQEMIPSYGKSLIEDVDLM
RKIRQQTSKDLELNYYE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgccaactcaatcagaacctaaagacattgtcattattggtgccggtgtgctaagtacg
actttcgcttcaatgattaaagatttagaaccagaatggaatcttaaattatatgaacgc
ctagacagtccaggtgtagaaagttcaaacgagcgtcataatgctggtactggccatgct
gcactttgtgaattgaactatacagtgaaacaacctgatggctcaattgacatcgaaaaa
gcaaaagaaatcaatgaagaattcgaaatctcaaaacaattttggagtcatcttgttaaa
agtaaaaacattgatacaccaagagatttcatcaatcctcttccacacattagcttcgta
cgcgggaagaataacgttcaattcttaaaagatcgttataataaaatgaaagatttccca
atgttcgacaatattgaatatacagaagatattgaagtgatgagaaaatggatgccgttg
atgatgcaaggtcgtagtgctagcgacatcatggctgcaagtaaaatcgacgaaggtact
gatgttaacttcggtgaattaactcgtaagatggctaaaagtatcgaagcgcataaaaat
gcagatgtacattataaccatgaagttagagacttcaaccgtcgtaaagatggtaaatgg
gaagttacagtggtcaaccgcaatacaggtgagtcacatgtacaacttgcagactatatc
ttcatcggtgctggtggcggtgcgattccgttgttacaaaaaacaggtattcctgaaagt
aaacatttaggtggtttcccaattacaggacaattcttaatgtgtacaaacccagatgtt
atcgaagaacatggtgtgaaagtatacggtaaagagccacctggtacaccaccaatgact
gtacctcacttagatacacgttatatcaacggccgtaaagcattattattcggacctttc
gcaagcatcggtcctaaattcttgaaaaatggttcgaacttagatttattcaaatctgta
aaaccatacaatattactactttacttgccgctgcggtgaaaaacttaccgttaattaaa
tactcaatcgatcaaatcttaatgactaaagaaggttgtatgaaccacttacgtacattc
taccctgaagctaaagatcaagattgggaattatatactgctggtaaacgtgtacaagtg
attaaagatactgaagaatacggtaaaggttacatccaattcggtacagaagtggtaaac
tcacaagaccatactgttattgctttattaggtgaatcaccaggagcttctacatcagtg
tctgtggcacttgaagtattagaacgcaactttgctgaatacgtacctgaatggacacct
aaattacaagaaatgattccttcttatggtaaatcattaattgaagatgttgatttaatg
agaaaaatacgtcaacaaacttcaaaagacttagaattaaactactacgagtaa

DBGET integrated database retrieval system