KEGG   Shewanella sediminis: Ssed_1708
Entry
Ssed_1708         CDS       T00596                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sse  Shewanella sediminis
Pathway
sse00620  Pyruvate metabolism
sse00640  Propanoate metabolism
sse00650  Butanoate metabolism
sse01100  Metabolic pathways
sse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ssed_1708
   00640 Propanoate metabolism
    Ssed_1708
   00650 Butanoate metabolism
    Ssed_1708
Enzymes [BR:sse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Ssed_1708
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABV36319
UniProt: A8FTZ6
Position
complement(2046645..2048927)
AA seq 760 aa
MTEKTEQFANAWAGFASGDWKTEVNVRDFIQANYTPYEGDEAFLAEATPATTQLWDKVMV
GIKQENSTHAPVDFDTKKVSTITSHEAGYIEQELETIVGLQTEAPLKRAMLPNGGIRMVE
GSCKAYGRELDSDVKYVYSELRKTHNQGVFDIYTPEIMRCRKSGVLTGLPDAYGRGRIIG
DYRRIALYGIDYLMADKFAQFGSLQAGFEAGEDLSSTMQLREEIAEQHRALGQMKQMAAS
YGFDISKPATNAQEAIQWTYFGYLAAVKSQNGAAMSLGRTSSFLDVFIERDLKNGTLTEE
QAQEMVDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIAGMGVDGRTLVTKSSFRFLHT
LYNMGASPEPNITVLWSEKLPLPFKKYCAKVSIDTSSIQYENDDLMRPDFASDDYAIACC
VSPMIVGQHMQFFGARANLAKTMLYAINGGLDEKLKTQIGPKFDAITSEVLDFDDVMGRL
DTMMDWLATQYVTALNSIHYMHDKYSYEAALMALHDRDVRRTMACGIAGLSIAADSLSAI
KFAKVKPIRDEHGIAVDFDIEGDYPKFGNNDARVDDLATELVERFMAKIRSMKMYRNAIP
TQSILTITSNVVYGKKTGTTPDGRPAGAPFAPGANPMHGRDEKGAVASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDEDGRRANLAALMDGYFAHNDSREGGQHLNVNVMNREMLEDAV
VNPDKYPQLTIRVSGYAVRFNALTPEQQQDVITRTFTQGM
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaccgaaaaaactgaacagtttgccaacgcatgggcaggtttcgcttctggcgattgg
aaaactgaagtcaacgttcgtgactttattcaagccaactacactccatatgagggtgat
gaagcattcctggccgaagcaactccagcgaccacccaactttgggataaagtgatggtt
gggatcaaacaggaaaacagcactcacgctcctgttgatttcgatactaagaaagtatca
acaattacatcacacgaagcgggttacatcgagcaagagcttgaaactatcgtcggctta
caaaccgaagctccactaaagcgtgccatgcttccaaatggcggcatccgtatggttgaa
ggttcttgtaaagcctacggccgtgaactggactcagatgttaagtacgtctattcagag
ctacgtaagactcataaccaaggtgtattcgatatctacacacctgaaatcatgcgttgt
cgtaagtctggtgtcttaactggtttgcctgatgcttatggccgtggtcgtatcatcggt
gattaccgtcgtatcgccctttatggtatcgattacctgatggccgataagtttgctcag
tttggctcacttcaggctggcttcgaagccggtgaagacttgtcttcaactatgcagctt
cgtgaagagattgcagagcaacatcgtgcactaggtcagatgaagcagatggcagccagc
tatggtttcgacatctctaagcctgcaactaacgcacaagaagcgattcagtggacttac
ttcggttatttagccgcagttaagagccaaaatggcgcagccatgtctcttggtcgtact
tcaagtttcctcgatgtcttcatcgaacgtgaccttaaaaatggcacactaactgaagaa
caagctcaagagatggttgaccatttcgtgatgaagctacgtatggttcgtttcctacgt
actcctgaatacgatgagttattctctggtgatccaatctgggcaactgaatctatcgcc
ggtatgggtgttgacggacgtactctggttactaagtcgagcttccgtttcttgcacact
ctatacaacatgggtgcgagtccagagccaaacatcactgtattgtggtcagagaagcta
ccattacctttcaaaaagtactgtgcaaaggtctctatcgacactagctcaatccagtat
gaaaatgatgatttgatgcgtcctgatttcgcgtcagatgactatgcaatcgcatgttgt
gttagccctatgattgtaggtcagcacatgcagttcttcggggctcgagctaacctcgca
aaaacgatgctttacgccatcaacggcggcttggatgaaaaacttaagactcagatcggt
cctaagttcgatgccatcacatctgaagttttagactttgatgacgttatgggtcgcctc
gacaccatgatggattggttagcgacacaatatgtgactgcgcttaactctatccactac
atgcacgacaaatactcttatgaagcagctctaatggcacttcatgaccgtgacgttcgt
cgcactatggcgtgtggtattgccggtctttctatcgctgccgattcactttctgcaatc
aagtttgcgaaggttaagccaatccgtgatgagcacggcatcgctgtcgatttcgacatc
gaaggtgactatcctaagtttggtaacaacgacgcacgcgtcgatgacttagctactgag
cttgtagagcgctttatggctaagatccgtagcatgaagatgtaccgtaacgcgatccct
actcagtcaattcttaccatcacttctaacgttgtgtacggtaagaaaacaggtacgact
ccagacggtcgtccagcgggcgcaccatttgctccgggcgcaaaccctatgcatggtcgt
gacgagaaaggtgcggtagcttcattaacttctgttgctaaactgccatttgctcacgct
caggatggtatctcatatactttctctatcgtaccaaatgcgttaggtaaagatgaagac
ggacgtcgcgctaacttagcagctctgatggacggttacttcgctcataatgacagccgc
gaaggtggtcaacacctgaacgttaacgttatgaaccgtgaaatgcttgaagatgcagtg
gttaatccagataaatacccacagcttaccattcgagtatcaggctatgcagttcgcttt
aatgcattgactcctgagcagcagcaagacgttatcactcgtacctttactcaaggtatg
taa

DBGET integrated database retrieval system