KEGG   Shewanella sediminis: Ssed_0962Help
Entry
Ssed_0962         CDS       T00596                                 

Definition
(GenBank) Bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
  KO
K01525  bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC:3.6.1.41]
Organism
sse  Shewanella sediminis
Pathway
sse00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Ssed_0962
Enzymes [BR:sse01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.41  bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
     Ssed_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ABV35573
UniProt: A8FRV0
Position
complement(1144581..1145405)
Genome map
AA seq 274 aa AA seqDB search
MAHYFVGDIQGCFEELQLLLNNVDFNPSKDQLWAVGDLVARGPGSLETLRYFRQLEGSGR
VVLGNHDLHLLAVNAKIKRANPNDKLGPLLTAPDIGSLIDWLRMQPLYQELPEHNLVMTH
AGVPPQWSLETLREEADHVAAALRSDDYLTSLICHMYTNGSNCWHDSMSELERKIYCINA
LTRMRFLHSDGRLDFDCKLPPSACEDPDLSPWFEHSGLLNSTHTLVFGHWAAVMGKVPSS
TIHALDTGCCWGEHLTLWHLESNQKITQNKLKKS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgcattattttgttggtgatattcaaggatgcttcgaagagttacagctcctcctg
aataatgtcgactttaacccatcaaaagatcagctttgggctgtcggggatcttgtggca
agaggcccggggtcgctggaaaccctacgttactttcggcaacttgaaggctctggacga
gtggtgctgggaaatcatgaccttcaccttcttgcggttaatgccaaaattaagagagcc
aatcccaatgacaagctcggcccgttactcactgcacccgatattggctctctgattgac
tggttacgaatgcaaccactttaccaagagctgcctgagcataatctggtgatgactcat
gcgggagttcctccccagtggagtcttgaaaccttaagagaggaggcggaccatgttgct
gcagcgctgagatcagatgattacctcacctctcttatctgtcatatgtatactaatggt
tcaaattgctggcacgactccatgtctgaattagagcgtaaaatatactgcatcaatgcc
ctgacacgaatgaggtttctgcacagtgatgggaggctcgactttgactgcaaactacct
ccatcggcatgtgaagaccccgatctatcaccttggtttgagcactcaggtttgctgaac
tccacgcatacattagtcttcggacattgggccgccgtgatgggaaaagtaccgtcaagt
acaatacatgctctcgatacgggttgttgttggggagagcatctgactctctggcattta
gaatccaatcaaaaaataacccaaaacaagttaaaaaagagttaa

DBGET integrated database retrieval system