KEGG   Shewanella sediminis: Ssed_0963Help
Entry
Ssed_0963         CDS       T00596                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
sse  Shewanella sediminis
Brite
KEGG Orthology (KO) [BR:sse00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Ssed_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABV35574
UniProt: A8FRV1
Position
complement(1145440..1145820)
Genome map
AA seq 126 aa AA seqDB search
MTSLEDSIKVEVKTEYIEGQSSPTEERYLFRYTITIVNLGEKAVTLKSRYWSITDANNHN
SEVRGEGVVGETPTIEPDSAYQYTSGTVLETPLGVMQGSYTMITGEGESFKAQIPPFRLA
VPGMLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcactagaagactccatcaaggtcgaagtaaaaactgaatatattgaaggtcaa
tcttcccctaccgaagaaaggtacttgttcagatataccatcactatcgttaatctcggt
gaaaaagcggtgacactgaagagccgttactggtcaattaccgatgcgaataaccataat
agcgaagtgcggggagaaggcgtggttggtgagacgccaacaatagaacctgacagtgca
tatcaatataccagtggcacagtactggagactcctttgggggtcatgcaaggcagctac
actatgatcaccggcgaaggagagagctttaaggcgcaaatccctcctttcagactcgca
gtccctggcatgcttcactga

DBGET integrated database retrieval system