KEGG   Shewanella sediminis: Ssed_1107Help
Entry
Ssed_1107         CDS       T00596                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
sse  Shewanella sediminis
Brite
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Ssed_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABV35718
UniProt: A8FS95
Position
complement(1319016..1320269)
Genome map
AA seq 417 aa AA seqDB search
MRAIINIISLATLALTPGVLLALEAQEVELQGTPFTLAESCPPSFELIKEEEEKDRCRLV
NQYQFYDSVQGRGLGGTQTSLPRHRDGFTPEQIDLGRYLFFDPLLSKDGSISCASCHQPE
KGFSDDLDRSIGITGEKVGRGAPTLWNVAFLDKFFWDVRAKTLEEQAQGPLFDPGEMGNT
PENLLQTLRENGSYPSMFAQAFPEASRLELSQVYTAITAFQTTLISLNSRYDRYAHGYHE
ALTENEILGLNVFRSFVARCAECHQPPLFTNNQIAVIGTPEPQGRALDIGAEKTYDAPKL
RGAFKVPTLRNITKSAPYMHSGRYSKLRDAVKFYNDGRGNSIPDGESMLLHWHISEPDLT
DDELDRIVDFLGALTDESLTPKVPQAVPSGLAVIDEKYQQEKIKQNPSSKTKNQSGE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagagccatcatcaatatcatctcactcgctacattagctcttacacccggtgtcctc
ctggcgctagaggctcaggaggtagagctgcaaggtacgccgtttactctggcagagagc
tgcccccccagttttgagttgatcaaagaggaggaggagaaggatcgctgccgcctggtc
aatcaatatcaattttatgactcggttcaggggcgcggacttgggggtactcaaacttca
ctgcccagacacagagatggcttcactcccgagcagatcgatctcggccgatacctgttt
ttcgatccgctactgtcaaaagatggttcaatctcctgcgccagctgtcaccagccggaa
aagggattcagcgacgatctggacagaagcataggaattacaggtgagaaagtcggccga
ggggctccgacactgtggaacgtcgcctttctggacaagttcttctgggatgtgcgtgca
aagaccctggaggaacaggcccagggaccgctgtttgacccgggcgagatgggcaatacg
cccgagaatctactgcaaaccctgagggagaatggcagctacccttcaatgtttgctcag
gccttcccggaagcttcccggttagaactttcacaggtctatactgcgataaccgccttt
cagacgacacttatctcactcaacagtcgctatgatcgctacgcccatggctatcacgaa
gcactgacggagaatgagatcttagggttgaatgtatttcgatccttcgtcgccagatgc
gccgagtgccaccagcctcctctgtttactaataatcagatagccgtaataggcacccct
gagccgcaaggtcgtgcgctcgacataggtgcagagaaaacctatgacgcaccaaaactt
cgtggcgcctttaaggttccaacactaagaaatatcacaaaatctgccccgtacatgcac
tcggggcgatatagcaaactcagagatgcggtcaaattttataacgatggacgtggcaac
tcgataccggatggggagagtatgttactgcactggcatatctctgagcccgatctcacc
gatgatgagctggaccgtattgtcgactttctcggcgcattaactgacgagagcctcacc
cctaaagttccacaggcggtcccatcgggactcgcggtaatcgatgaaaaataccaacag
gaaaaaataaaacaaaacccgagcagtaaaactaaaaatcagagcggagaataa

DBGET integrated database retrieval system