KEGG   Shewanella sediminis: Ssed_1415Help
Entry
Ssed_1415         CDS       T00596                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sse  Shewanella sediminis
Pathway
sse00630  Glyoxylate and dicarboxylate metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01200  Carbon metabolism
Module
sse_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ssed_1415
Enzymes [BR:sse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ssed_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABV36026
UniProt: A8FT53
Position
1678176..1679501
Genome map
AA seq 441 aa AA seqDB search
MNKASIPVSRQEQIQAIEKDWSENSRWKGVTRPYTAEDVVALRGSMVPENTLAKRGAARL
WELVNGGAKKGYVNSLGTLSGGQAVQQAKAGIEAIYLSGWQVAADANLAGAMYPDQSLYP
SNSVPAVLNNINSAFRRADQIQWSNGLNPGDEGYRDYFLPIVADAEAGFGGVLNSFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTKEAIQKLVSARLAADVCGVETLVIART
DANGADLLTSDCDPYDSDFITGDKCEEGFYRVKAGIEQAISRGLAYAPFADLIWCETETP
CLDEARKFADAIHEHFPDQLLAYNCSPSFNWKKNLDDETISHFQRELSQMGYKYQFITLA
GIHSMWYNMFDLAYDCARGEGVKHYVEKVQEAEFAAARKGYTFVAHQQEVGTGYFDRVTN
VIQGGHSSVTALTGSTEEKQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggcatcgatacctgtttcacggcaggagcagattcaagccattgagaaggat
tggagtgagaactctcgttggaaaggggtcacccgtccctatacggccgaggatgtggtg
gccctgcgaggctcaatggtcccggagaatacgttggcgaaacgtggcgccgccagatta
tgggaactggttaacggaggcgctaagaaaggctacgttaattcactcggcaccttaagc
ggtggtcaggcggttcagcaggcgaaggcggggatagaggcgatatacctgtcgggttgg
caggttgcggccgatgcgaatttggccggggctatgtaccccgatcagtcactctatccg
tctaactcggtaccggcggtgctaaataatatcaatagtgcgtttcgccgtgcagatcag
atccagtggagcaatggactcaaccctggggatgaaggttacagagactatttcttaccc
atagttgccgatgctgaagctggcttcggtggagtactcaattcgttcgagttgatgaag
agtatgatcgatgccggtgctgccggggtacattttgaagaccaactcgcatcggtgaaa
aaatgtggccacatggggggcaaggtgctcgttccgacgaaagaggcgatccaaaaactg
gtgagtgcgaggctggcagcggatgtgtgtggggtggagaccttagtcatagcccgcacc
gatgccaacggagccgatctgctgacctcagattgtgatccctatgacagtgatttcatc
acgggagataaatgtgaggaggggttctaccgtgtaaaagccggaattgagcaggccata
tcccgtggtttggcttacgccccttttgccgatcttatctggtgtgaaacagagacgccc
tgtctcgatgaggccagaaagtttgccgatgccattcacgagcactttccggatcaactg
ttggcttacaactgctccccctcatttaactggaagaaaaatttggatgacgagaccatc
tcgcattttcagagagagctgtcgcagatggggtataagtatcaatttatcaccttagcg
ggcattcacagcatgtggtacaacatgttcgatctggcctatgactgtgctcggggagag
ggggttaaacactatgtcgaaaaggtgcaggaggcggaatttgcggcggcaaggaaaggc
tataccttcgtggcacaccagcaagaggtgggcacaggctacttcgaccgggtaacgaat
gtgatccagggcggtcactcctcggtgacggcattaaccggctcgaccgaagagaaacag
ttttaa

DBGET integrated database retrieval system