KEGG   Shewanella sediminis: Ssed_1473Help
Entry
Ssed_1473         CDS       T00596                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sse  Shewanella sediminis
Pathway
sse00071  Fatty acid degradation
sse00072  Synthesis and degradation of ketone bodies
sse00280  Valine, leucine and isoleucine degradation
sse00310  Lysine degradation
sse00362  Benzoate degradation
sse00380  Tryptophan metabolism
sse00620  Pyruvate metabolism
sse00630  Glyoxylate and dicarboxylate metabolism
sse00640  Propanoate metabolism
sse00650  Butanoate metabolism
sse00900  Terpenoid backbone biosynthesis
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01130  Biosynthesis of antibiotics
sse01200  Carbon metabolism
sse01212  Fatty acid metabolism
sse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ssed_1473
   00630 Glyoxylate and dicarboxylate metabolism
    Ssed_1473
   00640 Propanoate metabolism
    Ssed_1473
   00650 Butanoate metabolism
    Ssed_1473
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ssed_1473
   00072 Synthesis and degradation of ketone bodies
    Ssed_1473
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ssed_1473
   00310 Lysine degradation
    Ssed_1473
   00380 Tryptophan metabolism
    Ssed_1473
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ssed_1473
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ssed_1473
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ssed_1473
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sse04147]
    Ssed_1473
Enzymes [BR:sse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ssed_1473
Exosome [BR:sse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ssed_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABV36084
UniProt: A8FTB1
Position
1747063..1748253
Genome map
AA seq 396 aa AA seqDB search
MSTEQSNPDIVIVAAKRTPMGGFQGALSSVASPKLAATAIKGLMDQTGLPEEQLDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSASVVVAGG
MESMSQAPYLLDKARGGMRMGHGKVMDHMFLDGLEDAYTGGAMGTFAQETADDFNLTREQ
MDTFALSSLEKANAAIESGAFKEEITPVTVSSRRGDTLVDTDEQPGNARPDKIPSLRPAF
AKDGTITAANSSSISDGAAALMLMTAEQANSMGLPVLATIKGHTTHAQEPSMFTTAPVGA
MNKLLDKVNWSKDDVDLFEINEAFAMVTMLAISELSLDESKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagagcagtcaaacccagatatcgtaatcgttgccgctaaacgtacccctatg
ggtggatttcaaggggcattgtcgagcgtggcttcaccgaagttggccgcgacggccatc
aaggggctaatggatcagaccggattgcctgaagagcagctcgatgaagtgttgatgggg
tgtgtactgcctgcgggactgggtcaagctccggctcgtcaagcgacattaggcgctgga
ctccctctgtctgttggtgcgacaacggtgaataaagtctgtggctcgggtatgaagacc
gttatgttggctcatgatctgattaaagctggcagtgcctcagtcgttgttgccggtggc
atggagagtatgagccaggcgccatacctactcgataaagcccgtggtggaatgcgtatg
gggcacggtaaggtgatggaccatatgttccttgatggcctcgaagatgcctataccggt
ggtgccatgggcacatttgctcaagagacggccgatgatttcaacttgacccgagagcag
atggatacatttgcgctgagctcactcgaaaaagccaatgccgcgattgaaagcggtgcc
tttaaagaggagataaccccggtgacggtttccagtcgtcgcggcgatacccttgtcgat
accgatgagcagccgggcaatgcacgtccggataagatcccaagcttacgcccggccttt
gctaaagatggcaccatcacggcggcgaactcaagctctatctcagatggcgcagctgcc
ttgatgttgatgacggctgagcaggctaattcaatgggattacctgtgctcgccaccatc
aaggggcataccactcatgcacaggagccatcgatgtttacgacagccccagtcggtgcc
atgaataagctgctcgataaggtgaactggagcaaggatgatgtggatctgtttgagatc
aacgaagcctttgccatggtgaccatgctggctatctctgagctatcgctcgatgaatcg
aaggtaaacgtcaacggtggcgcgtgtgcgcttggtcatcctatcggctgctccggcgcg
cgattattagtgacgttaatccatgcccttaaggcgcgtggccttaagcgaggcgtcgcc
tccttgtgtatcggtggtggcgaggcgacggcgatggccatcgaagtctag

DBGET integrated database retrieval system